Recombinant Mouse Von Willebrand Factor (VWF) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-10473P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Von Willebrand Factor (VWF) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-10473P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Von Willebrand Factor (VWF) Protein (His&Myc) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q8CIZ8 |
| Target Symbol | VWF |
| Synonyms | Vwfvon Willebrand factor; vWF) [Cleaved into: von Willebrand antigen 2; von Willebrand antigen II)] |
| Species | Mus musculus (Mouse) |
| Expression System | Yeast |
| Tag | N-6His&C-Myc |
| Target Protein Sequence | DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV |
| Expression Range | 1498-1665aa |
| Protein Length | Partial |
| Mol. Weight | 22.3 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma. |
| Subcellular Location | Secreted. Secreted, extracellular space, extracellular matrix. |
| Database References | KEGG: mmu:22371 STRING: 10090.ENSMUSP00000001995 UniGene: PMID: 29392565 |
