Recombinant Mouse Tyrosine-Protein Kinase Mer (MERTK) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05755P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Mertk at 2 μg/ml can bind anti-MERTK recombinant antibody, the EC 50 is 19.22-25.80 ng/mL. Biological Activity Assay
Recombinant Mouse Tyrosine-Protein Kinase Mer (MERTK) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05755P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Tyrosine-Protein Kinase Mer (MERTK) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Mertk at 2 μg/mL can bind anti-MERTK recombinant antibody, the EC 50 is 19.22-25.80 ng/mL. |
| Uniprotkb | Q60805 |
| Target Symbol | MERTK |
| Synonyms | (Proto-oncogene c-Mer)(Receptor tyrosine kinase MerTK) |
| Species | Mus musculus (Mouse) |
| Expression System | Mammalian cell |
| Tag | C-10His |
| Target Protein Sequence | GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSM |
| Expression Range | 19-497aa |
| Protein Length | Partial |
| Mol. Weight | 55.0 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including LGALS3, TUB, TULP1 or GAS6. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Ligand binding at the cell surface induces autophosphorylation of MERTK on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Protein kinase superfamily, Tyr protein kinase family, AXL/UFO subfamily |
| Database References | KEGG: mmu:17289 STRING: 10090.ENSMUSP00000014505 UniGene: PMID: 29310530 |
