Recombinant Mouse Tyrosine-Protein Kinase Mer (MERTK) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05755P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Mertk at 2 μg/ml can bind anti-MERTK recombinant antibody, the EC 50 is 19.22-25.80 ng/mL. Biological Activity Assay
Recombinant Mouse Tyrosine-Protein Kinase Mer (MERTK) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05755P
Collections: Enzymes, Featured enzyme molecules, Kinase, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Tyrosine-Protein Kinase Mer (MERTK) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Mertk at 2 μg/mL can bind anti-MERTK recombinant antibody, the EC 50 is 19.22-25.80 ng/mL. |
| Uniprotkb | Q60805 |
| Target Symbol | MERTK |
| Synonyms | (Proto-oncogene c-Mer)(Receptor tyrosine kinase MerTK) |
| Species | Mus musculus (Mouse) |
| Expression System | Mammalian cell |
| Tag | C-10His |
| Target Protein Sequence | GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSM |
| Expression Range | 19-497aa |
| Protein Length | Partial |
| Mol. Weight | 55.0 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including LGALS3, TUB, TULP1 or GAS6. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Ligand binding at the cell surface induces autophosphorylation of MERTK on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Protein Families | Protein kinase superfamily, Tyr protein kinase family, AXL/UFO subfamily |
| Database References | |
| Tissue Specificity | Expressed predominantly in the hematopoietic lineages: macrophages, NK cells, NKT cells, dendritic cells and platelets. |
Gene Functions References
- These results suggest that MerTK inhibition impaired phagocytic function of the retina PMID: 29310530
- MerTK does not play an essential role in the phagocytosis of S. aureus but attenuates inflammation induced by staphylococcal LTA through blocking NF-kappaB activation. PMID: 28528507
- Tumor macrophage expression of Mertk is a therapeutic target to prevent tumor recurrence following radiation therapy. PMID: 27602953
- Hypercapnic Acidosis Regulates Mer Tyrosine Kinase Receptor Shedding and Activity. PMID: 29286859
- GC B cell-intrinsic sensing of self-RNA, but not self-DNA, from dead cells in GCs drives enhanced GC responses in Mer(-/-) mice. Mer loss in dendritic cells promotes enhanced T cell activation and proinflammatory cytokine production. Mer immunoregulatory signaling in APCs regulates B cell selection and autoimmunity. The phagocytic and immunomodulatory functions of Mer regulate GC responses preventing autoimmunity. PMID: 29118245
- this study shows that viral infection sensitizes fetal membranes by MERTK Inhibition PMID: 28916522
- Monocyte-induced MerTK cleavage on proreparative MHCII(LO) cardiac macrophages is a novel contributor to myocardial ischemic reperfusion injury. PMID: 28851810
- evidence that proteolytic cleavage of the macrophage efferocytosis receptor c-Mer tyrosine kinase (MerTK) reduces efferocytosis and promotes plaque necrosis and defective resolution. PMID: 28067670
- these results suggest, for the first time, that MerTK is an intracellular negative feedback regulator that inhibits the inflammatory response of lipoteichoic acid -stimulated macrophages PMID: 27419619
- the reciprocal activation of Axl and Mer receptor tyrosine kinases has a major impact on the outcome of renal inflammation. PMID: 27527599
- Reduced transcription of Mertk, rather than differences in MERTK protein structure, determines the reduced efficiency of apoptotic cell clearance in the Aath4a(DBA/DBA) mice, which, in turn, contributes to their increased susceptibility to atherosclerosis. PMID: 28473436
- Axl, Mertk and Tyro3 receptors are not required for Zika virus entry and infection. PMID: 28423319
- Signaling through the Mer proto-oncogene tyrosine kinase (MerTK) receptor in cultured macrophages and in sterile inflammation in vivo promotes specialized proresolving mediator (SPM) biosynthesis by a mechanism involving an increase in the cytoplasmic:nuclear ratio of a key SPM biosynthetic enzyme, 5-lipoxygenase. PMID: 27199481
- These studies define the clearance of infected, apoptotic neutrophils by dendritic cells and Mer receptor signaling as central to the early immune evasion strategies of L. major. PMID: 26658192
- Tyro3 gene dosage modulates Mertk-associated retinal degeneration, provide strong evidence for a direct role for TYRO3 in RPE phagocytosis, and suggest that an eQTL can modify a recessive Inherited photoreceptor degenerations. PMID: 26656104
- Activation of Mertk synergized with interferon-beta to tighten cell junctions and prevent virus transit across brain microvascular endothelial cells. PMID: 26523970
- results establish TAM receptors as both controllers of microglial physiology and potential targets for therapeutic intervention in central nervous system disease PMID: 27049947
- Loss of Mertk alters expression of micrornas in retinal pigment epithelial cells. PMID: 25604732
- These results suggest that TAM receptors support NSCs survival, proliferation and differentiation by regulating expression of neurotrophins, especially the nerve growth factor. PMID: 25514676
- Mertk deficiency affects not only phagocytosis but also cell shape and migration PMID: 25617898
- The results indicate that Axl and Mer receptors cooperatively regulate the systemic immune tolerance to male germ cell antigens. PMID: 25403570
- Enhanced Mer signaling during the recovery phase increases the abundance and activity of LXR to inactivate the inflammatory response in macrophages PMID: 25714463
- nuclear receptor agonists increase MerTK and Axl expression on plaque-associated immune cells, consequently licensing their phagocytic activity and promoting plaque clearance. PMID: 25904803
- Mertk expression is required for optimal B-cell antigen presentation, which is, in turn, required in this model for optimal T cell activation and subsequent T cell-dependent B cell differentiation. PMID: 24768065
- adiponectin elicited Mer expression and Mer-dependent efferocytosis in macrophages similar to cells stimulated with C1q. PMID: 24942043
- Optimal TAM signaling requires coincident TAM ligand engagement of both its receptor and the phospholipid phosphatidylserine regulating TAM receptor tyrosine kinases Tyro3, Axl, and Mer and their ligands Gas6 and Protein S. PMID: 25265470
- data suggest that MerTK cleavage contributes to the acute regulation of RPE phagocytosis by limiting POS binding to the cell surface. PMID: 25538233
- Inhibition of the Gas6 receptor Mer or therapeutic targeting of Gas6 by warfarin reduced myeloma burden and improved survival in a systemic model of myeloma. PMID: 25102945
- Mer mediates quiescence and chemotherapy resistance in a CNS co-culture model and causes CNS infiltration in immunodeficient mice. PMID: 25428221
- Data indicate that TAM receptor tyrosine kinases Axl and Mer had distinct roles as phagocytic receptors. PMID: 25194421
- Data indicate that MerTK, a receptor kinase, was essential for the engulfment of pyrenocytes by the central macrophages at erythroblastic islands. PMID: 24659633
- Data collectively and directly link efferocytosis to wound healing in the heart and identify Mertk as a significant link between acute inflammation resolution and organ function. PMID: 23836795
- the engulfment of apoptotic cells by resident peritoneal macrophages proceeds in two steps: binding to Tim4, a PtdSer receptor, followed by MerTK-mediated cell engulfment PMID: 24515440
- Axl and Mer (TAM) receptor tyrosine kinases (RTKs) developed persistent inflammatory liver damage resembling AIH. Tyro3(-/-)Axl(-/-)Mer(-/-) triple mutant (TAM(-/-)) mice exhibited chronic hepatitis PMID: 23799121
- Adult brain neurogenesis is reduced in the hippocampus of the Tyro3-/-Axl-/-Mertk-/- triple-knockout & Axl-/-Mertk-/- double-knockout mouse brains, but not in single Mertk-/- knockouts. PMID: 24244024
- Chronic systemic inflammation and autoimmune disorders in the Tyro3, Axl and Mertk knockout mice cause neuronal damage and death. PMID: 23840307
- studies reveal a novel role for astrocytes in mediating synapse elimination in the developing and adult brain, identify MEGF10 and MERTK as critical proteins in the synapse remodelling underlying neural circuit refinement PMID: 24270812
- Data indicate the two phagocytic proteins, Mer receptor tyrosine kinase (MerTK) and Milk fat globule EGF-like factor 8 (MFG-E8), were transiently up-regulated by macrophages/microglia after focal brain ischemia in vivo. PMID: 24101459
- Data indicate that azoxymethane (AOM) and dextran sulfate sodium (DSS)-induced inflammation-associated cancer is exacerbated in mice lacking Axl and Mer receptor tyrosine kinases. PMID: 23878224
- MerTK signaling may suppress antitumor immunity through suppression of CD8+ T lymphocyte proliferation. PMID: 23867499
- Mer deficiency in knockout mice results in long-term accumulation of apoptotic cells primarily in germinal centers and not in the T cell zone, marginal zone, or red pulp areas of the spleen. PMID: 23319738
- Results demonstrate that Protein S and Gas6 function as independent, bona fide Mer ligands, and are, to a first approximation, interchangeable with respect to Mer-driven phagocytosis in the retina. PMID: 23259948
- Mer of the TAM-family receptors is responsible for mediating transcriptional HGF production through a RhoA-dependent pathway. PMID: 22740630
- These results suggest that tubby is a ligand to facilitate microglial phagocytosis through MerTK for the maintenance of CNS homeostasis. PMID: 22884297
- Inhibiting Mer receptor tyrosine kinase suppresses STAT1, SOCS1/3, and NF-kappaB activation and enhances inflammatory responses in lipopolysaccharide-induced acute lung injury. PMID: 22427680
- Novel insight into the mechanism of TAM RTKs (Tyro3, Axl, Mer receptor tyrosine kinases)in regulating male fertility. PMID: 19602523
- A TRIF-mediated pattern recognition receptor signaling cascade requires NADPH oxidase to activate PKCdelta and then p38, culminating in ADAM17-mediated proteolysis of MerTK. PMID: 21828049
- TNF family members play a role in protecting photoreceptors of Mertk(nmf12) homozygotes from cell death. PMID: 21436282
- ERG from mer(kd) mice of different ages showed inner retinal dysfunction in mer(kd) mice. This and faster degeneration in mer(kd) mice may produce retinal environment unresponsive to neuroprotection from subretinal electrical stimulation. PMID: 21467171
- disrupted expression leads to enhanced marginal zone B-cell responses PMID: 20822883
