Recombinant Mouse Tyrosine-Protein Kinase Jak3 (JAK3) Protein (His)

Name: Recombinant Mouse Tyrosine-Protein Kinase Jak3 (JAK3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10421P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Tyrosine-Protein Kinase Jak3 (JAK3) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q62137
Target Symbol	JAK3
Synonyms	Jak3; Tyrosine-protein kinase JAK3; EC 2.7.10.2; Janus kinase 3; JAK-3
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	LKYISLLGKGNFGSVELCRYDPLGDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVKIADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHDRPAFGTLSPQLDALWRGRPG
Expression Range	818-1100aa
Protein Length	Partial
Mol. Weight	36.2kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Non-receptor tyrosine kinase involved in various processes such as cell growth, development, or differentiation. Mediates essential signaling events in both innate and adaptive immunity and plays a crucial role in hematopoiesis during T-cells development. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors sharing the common subunit gamma such as IL2R, IL4R, IL7R, IL9R, IL15R and IL21R. Following ligand binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, upon IL2R activation by IL2, JAK1 and JAK3 molecules bind to IL2R beta (IL2RB) and gamma chain (IL2RG) subunits inducing the tyrosine phosphorylation of both receptor subunits on their cytoplasmic domain. Then, STAT5A AND STAT5B are recruited, phosphorylated and activated by JAK1 and JAK3. Once activated, dimerized STAT5 translocates to the nucleus and promotes the transcription of specific target genes in a cytokine-specific fashion.
Subcellular Location	Endomembrane system; Peripheral membrane protein. Cytoplasm.
Protein Families	Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Database References	KEGG: mmu:16453 STRING: 10090.ENSMUSP00000060073 UniGene: PMID: 28817455 JAK3 up-regulates SGLT1 activity by increasing the carrier protein abundance in the cell membrane, an effect enforcing cellular glucose uptake into activated lymphocytes and thus contributing to the immune response. PMID: 27595398 Foxp3 has a rapid turn over in Treg partly controlled at the transcriptional level by the JAK/STAT pathway PMID: 27077371 JAK3 contributes to the regulation of membrane Kv1.5 protein abundance and activity, an effect sensitive to ouabain and thus possibly involving Na(+)/K(+) ATPase activity. PMID: 26100849 JAK3 deficiency is followed by down-regulation of cytosolic Ca(2+) release, receptor and store operated Ca(2+) entry and Na(+)/Ca(2+) exchanger activity in dendritic cells. PMID: 26279433 Jak3 has a role in promoting mucosal tolerance through suppressed expression and limiting activation of TLRs thereby preventing intestinal and systemic chronic low-grade inflammation and associated obesity and MetS PMID: 26451047 Our results demonstrate that JAK3/STAT6 has an important role in bone marrow-derived fibroblast activation, extracellular matrix production, and interstitial fibrosis development. PMID: 26032813 results showed that different JAK3 mutations induce constitutive activation through distinct mechanisms, pointing to specific therapeutic perspectives PMID: 26446793 JAK3 down-regulates Na(+)/K(+)-ATPase activity, an effect involving gene expression and profoundly curtailing ATP consumption. PMID: 26021261 In conclusion, JAK3 deficiency leads to increased formation of calcitriol, which contributes to or even accounts for increased release of FGF23 and enhanced intestinal phosphate absorption. PMID: 25493954 JAK3 deficiency leads to intestinal sodium (Na+) loss, decrease of blood pressure, increased aldosterone release and subsequent stimulation of renal tubular Na(+) reabsorption. PMID: 24281140 JAK3 is a powerful regulator of the peptide transporters PEPT1 and PEPT2. PMID: 23934551 cPLA2, p38 mitogen-activated protein kinase (MAPK), and Janus kinase 3 (JAK3) signaling are necessary for F. tularensis-induced PGE2 production. PMID: 24343645 the essential role of Jak3 in the colon where it facilitated mucosal differentiation by promoting the expression of differentiation markers and enhanced colonic barrier functions through AJ localization of beta-catenin. PMID: 24045942 The potential effects of pharmacological JAK3 inhibition in a myocardial ischemia and reperfusion injury model, were investigated. PMID: 23680658 Inhibition of JAK3 suppressed phosphorylation of PI3K downstream effectors including Akt, mammalian target of rapamycin complex 1, glycogen synthase kinase 3beta, and CREB. JAK3 differentially regulates TLR-mediated inflammatory cytokine production. PMID: 23797672 hemagglutinin of H5N1 avian influenza triggered an abnormal innate immune signalling in the pulmonary epithelial cells, through an unusual process involving activation of Janus kinase 3 PMID: 22359619 analysis of the biochemistry, immunological functions, and clinical significance of JAK3 [review] PMID: 22130498 These findings highlight the pathological role of CD8(+) T cells and Jak3-dependent IFN-gamma-mediated Th1 responses in cerebral malaria pathogenesis. PMID: 22363534 JAK3 inhibition potently facilitates myoblast differentiation through antagonistic STAT1/STAT3 activities. PMID: 22120524 dominant-negative mutants of either Cullin1 or Cullin5, which lack the C terminus responsible for recruiting the E2 enzymes, were able to prevent JAK3 degradation induced by both ASB2/SKP2 and NOTCH signaling. PMID: 21969365 This study defines a novel JAK3 mutation among patients with N-DS AML and demonstrates that normal individuals can also display germline JAK3 substitutions, previously proven to have oncogenic properties, in vitro and in vivo. PMID: 21599579 Janus kinase 3 is expressed in erythrocytes, phosphorylated upon energy depletion and involved in the regulation of suicidal erythrocyte death. PMID: 21691072 Human cord blood-derived CD34+ hematopoietic stem cells were successfully engrafted into Balb/c Rag-2-/-Jak3-/- mice; however, the engraftment rate was far lower in C57/BL6 Rag-2-/-Jak3-/- mice. PMID: 21331358 Jak3 inhibition induced neuronal differentiation accompanied by neurite growth. PMID: 20979137 the CD69 cytoplasmic tail associates with the Jak3/Stat5 signaling pathway, which regulates the transcription of RORgammat and, consequently, differentiation toward the Th17 lineage PMID: 20696842 despite its dependence on leukemia inhibitory factor, JAK3 is not essential for LIF-mediated photoreceptor protection or gene expression. PMID: 20345762 Jak3 is important for dendritic cell maturation, migration and function, through a CCR7-mediated signalling pathway PMID: 19759904 Nonhematopoietic expression of Janus kinase 3 is required for eosinophilic airway inflammation PMID: 11859141 plays several important roles in B cells: during development, to enable cell division, Ig gene rearrangement and cell differentiation, and in mature cells, to promote B cell survival in the periphery PMID: 12147626 Activation of this pathway is associated with granulocytic differentiation of myeloid precursor cells PMID: 12351382 observations establish JAK3 as a key mediator of severe GVHD after allogeneic BMT in the context of a major-HLA disparity PMID: 12389628 Jak3 is a primary response gene for interleukin-6 in macrophage differentiation, and ectopic overexpression of Jak3 accelerates monocytic differentiation of normal mouse bone marrow cells stimulated with cytokines PMID: 14976041 Jak3 is not essential for dendritic cell development but unexpectedly appears to be an important negative regulator PMID: 16020505 the effect of IL-15 and IL-21, which are closely related to IL-2 and share the usage of the common gamma chain and of its JAK3-associated pathway. PMID: 17938255 PDGFRalpha and JAK3 have roles in Galpha(12)-mediated cell proliferation PMID: 18038259 The efficacy observed with CP-690550 in collagen-induced arthritis and adjuvant arthritis suggests JAK3 inhibition may represent novel therapeutic target for treatment of rheumatoid arthritis. PMID: 18234077 data indicate that Janus-kinase-3 regulates epigenetic modification and chromatin remodeling of the Ifng locus during Th1 cell differentiation PMID: 18549798 somatic loss of BLNK and concomitant mutations leading to constitutive activation of Jak3/STAT5 pathway result in the generation of pre-B-cell leukemia PMID: 19047679 functions of JAK3 in the development of skin immune responses and diseases such as psoriasis PMID: 19596999

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.