Recombinant Mouse Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07665P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07665P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q64514 |
Target Symbol | TPP2 |
Synonyms | Tripeptidyl aminopeptidase (Tripeptidyl-peptidase II) (TPP-II) |
Species | Mus musculus (Mouse) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH |
Expression Range | 44-264aa |
Protein Length | Partial |
Mol. Weight | 29.5 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited. Stimulates adipogenesis. |
Subcellular Location | Cytoplasm. Nucleus. Note=Translocates to the nucleus in responce to gamma-irradiation. |
Protein Families | Peptidase S8 family |
Database References | |
Tissue Specificity | Expressed in the brain, skeletal muscle, gonadal and mesenteric white adipose tissue and brown adipose tissues. |
Gene Functions References
- Data indicate that TPPII can regulate sperm maturation by modulating intracellular Ca(2+) stores via the type 3 RyR. PMID: 23818952
- Previously unknown differences between TPP II orthologues and subtilisin as well as features that might be conserved within the entire family of subtilisin-like serine peptidases. PMID: 22266401
- Tripeptidyl peptidase II is crucial for nucleoprotein epitope generation during major histocompatibility complex class I complex viral antigen processing both in the presence and absence of lactacystin-sensitive proteasome action. PMID: 17088258
- TPPII is not generally required for the production of major histocompatibility class I-restricted peptides, but presentation of some peptides can be negatively affected by TPPII. PMID: 17357105
- Data show that mice that were homozygous for an insertion in the Tpp2 locus were embryonic lethal and Tpp2 heterozygous mutants were lean compared with wild-type littermates, although food intake was normal. PMID: 17932511
- The data suggest a moderate, predominantly destructive role of TPPII in class I Ag processing. PMID: 18056356
- TPPII is important for maintaining normal cellular and systemic physiology, which may be relevant for potential therapeutic applications of TPPII inhibitors PMID: 18362329
- These results do not support a generally important role of TPPII for viability and proliferation of transformed cells or their p53-mediated DNA damage response. PMID: 19539606
- These data indicate that while TPPII contributes to the trimming of peptides with very long N-terminal extensions, TPPII is not essential for generating most MHC class I-presented peptides or for stimulating CTL responses to several Ags in vivo. PMID: 19841172