Recombinant Mouse Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04767P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04767P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Tripeptidyl-Peptidase 2 (TPP2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q64514 |
| Target Symbol | TPP2 |
| Synonyms | Tpp2; Tripeptidyl-peptidase 2; TPP-2; EC 3.4.14.10; Tripeptidyl aminopeptidase; Tripeptidyl-peptidase II; TPP-II |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | DTGVDPGAPGMQVTTDGKPKIIDIIDTTGSGDVNTATEVEPKDGEIIGLSGRVLKIPANWTNPLGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPIHRVALAEACRKQEEFDIANNGSSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGETWRACVDSNENGDLSKCAVLRNYKEAQEYSSFGTAEMLNYSVNIYDDGNLLSIVTSGGAH |
| Expression Range | 44-264aa |
| Protein Length | Partial |
| Mol. Weight | 29.5 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited. Stimulates adipogenesis. |
| Subcellular Location | Cytoplasm. Nucleus. Note=Translocates to the nucleus in responce to gamma-irradiation. |
| Protein Families | Peptidase S8 family |
| Database References | KEGG: mmu:22019 STRING: 10090.ENSMUSP00000085244 UniGene: PMID: 23818952 |
