Recombinant Mouse Transcription Factor Ap-2-Alpha (TFAP2A) Protein (His&Myc)

Name: Recombinant Mouse Transcription Factor Ap-2-Alpha (TFAP2A) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-09278P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Transcription Factor Ap-2-Alpha (TFAP2A) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P34056
Target Symbol	TFAP2A
Synonyms	Tfap2a; Ap2tf; Tcfap2aTranscription factor AP-2-alpha; AP2-alpha; AP-2 transcription factor; Activating enhancer-binding protein 2-alpha; Activator protein 2; AP-2
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALGSGLGDLPIHSLPHAIEDVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNSAKSSDKEEKHRK
Expression Range	1-437aa
Protein Length	Full Length
Mol. Weight	55.0 kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.
Subcellular Location	Nucleus.
Protein Families	AP-2 family
Database References	KEGG: mmu:21418 STRING: 10090.ENSMUSP00000105822 UniGene: Mm.487150

Gene Functions References

AP2gamma is present in a sub-population of hippocampal transient amplifying progenitors. There, it is found to act as a positive regulator of the cell fate determinants Tbr2 and NeuroD, promoting proliferation and differentiation of new glutamatergic granular neurons. Conditional ablation of AP2gamma in adult brain reduced hippocampal neurogenesis and disrupted coherence between ventral hippocampus and medial prefronta... PMID: 27777416
these findings reveal that the AP-2 genes have a major function in mammalian neural crest development, influencing patterning of the craniofacial skeleton PMID: 29229773
RNA interference of transcriptional factor activator protein 2alpha (AP-2alpha) reversed the inhibitory effects of aspirin on atherosclerosis in Apoe-/- mice. PMID: 27391154
Study systematically examined the expression profile of AP-2 family in the developing mouse and chick spinal cord and found that AP-2alpha and AP-2beta are specifically expressed in post-mitotic dorsal interneurons. Subsequent functional assessment in chick embryos demonstrated that AP-2alpha and AP-2beta have distinct functions in dorsal interneuron specification and differentiation. PMID: 27984181
MEX3C associates with the endolysosomal compartment through an endocytosis-like process. siRNA-mediated inhibition of the MEX3C or AP-2 complex substantially decreased exosomal but not cellular microRNA miR-451a expression PMID: 28982131
High AP-2 alpha phosphorylation is associated with abdominal aortic aneurysm. PMID: 28179583
overexpression of Dnmt3a partially rescued the impairment of adipogenesis induced by AP2alpha knockdown. PMID: 27906176
Data show that TFAP2A binds many of the same regulatory elements as MITF in melanocytes. PMID: 28249010
TFAP2A is a conserved component of the core network that regulates EMT, acting as a repressor of many genes, including ZEB2. PMID: 28412966
The AP-2beta transcription factor is an important effector of PITX2 function during corneal development, required for differentiation of corneal endothelium and establishment of angiogenic privilege. PMID: 26968737
the regulation of synaptic-vesicle (SV) recycling via early endosomes by the interdependent regulation of AP-2-mediated endocytosis and AP-1/sigma1B-mediated SV reformation, is reported. PMID: 25128028
the Tfap2a and Tfap2b transcription factors were identified as two major downstream effectors of Ptf1a. PMID: 25966682
Tfap2a-dependent changes in mouse facial morphology result in clefting that can be ameliorated by a reduction in Fgf8 gene dosage PMID: 25381013
By gain-of function and loss-of-function approaches, ap2a and 2b were identified to be the major downstream targets of Ptf1a to specify the amacrine cell fate. PMID: 25966682
results suggested that RNF20 may play roles in adipocyte differentiation by stimulating ubiquitin-proteasome-dependent degradation of AP-2alpha. PMID: 24374663
N-terminal peptide sequencing indicates use of a downstream start codon in the human ortholog of AP-2. PMID: 3063603
A conserved N-terminus is observed for alpha, beta, gamma, and epsilon members of this gene family. PMID: 14572467
AP-2alpha defines epididymis-specific androgen receptor recruitment. It is constitutively bound to chromatin and guides AR to specific genomic loci upon hormone exposure. PMID: 24451200
Nonsyndromic cleft palate in an animal model is associated with disruption of the Ap2beta1 gene. PMID: 20500056
our data indicate that miR-17-92 modulates expression of critical T-box transcriptional regulators during midface development and is itself a target of Bmp-signaling and the craniofacial pioneer factor AP-2alpha PMID: 24068957
critical roles for AP-2 activity in retinogenesis, delineating the overlapping expression patterns of Tcfap2a, Tcfap2b, and Tcfap2c in the neural retina, and revealing a redundant requirement for Tcfap2a and Tcfap2b in horizontal and amacrine cell development PMID: 22411557
Tcfap2a is proposed as a candidate genetic regulator of the level of voluntary physical activity through its influence on a dopaminergic pathway. PMID: 21978078
Whereas AP-2alpha/beta transcription factors are in vivo not required for the onset or maintenance of noradrenergic differentiation, their essential survival functions are demonstrated for sympathetic progenitors and noradrenergic neurons. PMID: 21539825
AP-2alpha knockout mice exhibit optic cup patterning defects and failure of optic stalk morphogenesis. PMID: 20150232
Expression of AP-2alpha transcription factors in breast cancer cells supports proliferation and contributes to chemo- and radiation-resistance of tumor cells by impairing the ability to induce apoptosis. PMID: 20459791
downregulation of repressive isoforms during adipocyte differentiation PMID: 11688971
Requirement for AP-2alpha in cardiac outflow tract morphogenesis. PMID: 11744375
The results support a role of AP-2alpha in the etiology of exencephalic disorders PMID: 11967920
ectopic expression in the lens disrupts fiber cell differentiation PMID: 11969252
AP-2alpha modulates human corticotropin-releasing hormone gene expression in the placenta by direct protein-protein interaction. PMID: 12062896
interactions among TFAP2A, CITED2, and p300/CBP are necessary for TFAP2A-mediated transcriptional activation and for normal neural tube and cardiac development. PMID: 12586840
role for the AP-2 proteins in regulating the proliferation and differentiation of mammary gland epithelial cells PMID: 12654297
AP-2alpha upregulation in both epithelial and mesenchymal hair follicle compartments was coordinated with initiation of major remodeling processes. PMID: 12839558
provides evidence suggesting that AP-2alpha is a negative regulator of chondrocyte differentiation PMID: 14969394
role in appropriate postnatal craniofacial morphogenesis PMID: 14975718
AP-2alpha directs important aspects of neural crest cell function PMID: 14975722
AP-2alpha is required for signaling from the surface ectoderm to the underlying mesoderm for proper development and closure of the ventral body wall. PMID: 15013802
Missense mutation leads to misshapen middle ear bones. Homozygotes die perinatally, showing prominent abnormal facial structures PMID: 15181535
Findings unveil a repressive role for AP-2alpha in governing EGFR gene transcription as epidermal cells exit the basal layer and withdraw from the cell cycle. PMID: 16449191
Colocalization of Pax6 and AP-2alpha was mainly observed in the proliferating central lens epithelium, the same region in which the lens stalk phenotype was observed in the double heterozygous Pax6(+/lacZ)/AP-2alpha(+/-) eyes. PMID: 17679940
These data demonstrate that, whereas AP-2alpha alone does not play an intrinsic role in retinogenesis, it has non-cell-autonomous effects on optic cup development. PMID: 17724084
major role for this enhancer resides within the limb bud, and it serves to maintain a level of Tcfap2a expression that limits the size of the hand plate and the associated number of digit primordia PMID: 17984226
findings presented in this study clearly demonstrate that AP-2 has cell-autonomous roles in lens vesicle separation and maintenance of the lens epithelial cell phenotype PMID: 18224708
PKC beta II upregulates TTP expression in activated macrophages. This regulation is mediated through the activation of transcription factor AP-2, and serves as an additional mechanism how PKC beta regulates the inflammatory process. PMID: 18594783
AP-2alpha and AP-2gamma, in concert with Notch, play an essential role in the terminal differentiation of the skin epidermis in mice. PMID: 18824566
These findings place IRF6 and AP-2alpha in the same developmental pathway and identify a high-frequency variant in a regulatory element contributing substantially to a common, complex disorder. PMID: 18836445
these studies support a tumor suppressor role for AP-2alpha in the gastrointestinal tract. PMID: 19376641
AP-2alpha regulated gene Axl is an essential player in GN-11 neuron migration. PMID: 19463168

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.