Recombinant Mouse Toll-Like Receptor 7 (TLR7) Protein (GST)

Name: Recombinant Mouse Toll-Like Receptor 7 (TLR7) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-04381P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Toll-Like Receptor 7 (TLR7) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P58681
Target Symbol	TLR7
Synonyms	Tlr7; Toll-like receptor 7
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS
Expression Range	27-348aa
Protein Length	Partial
Mol. Weight	63.8kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Endosomal receptor that plays a key role in innate and adaptive immunity. Controls host immune response against pathogens through recognition of uridine-containing single strand RNAs (ssRNAs) of viral origin or guanosine analogs. Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction. In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF-kappa-B and IRF7 to induce proinflammatory cytokines and interferons, respectively.
Subcellular Location	Endosome membrane. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Lysosome. Cytoplasmic vesicle, phagosome. Note=Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist.
Protein Families	Toll-like receptor family
Database References	KEGG: mmu:170743 STRING: 10090.ENSMUSP00000061853 UniGene: PMID: 29150602 The results demonstrate that TLR7 activation may trigger innate immunity pathways and induce apoptosis and hypoplasia of neonatal biliary trees in Balb/c mice. The novel findings give an implication of pathogenesis of infantile cholestasis, such as biliary atresia. PMID: 27590984 TLR7 deletion reduces atherosclerosis in apolipoprotein E-deficient mice. PMID: 28405010 SZU-101 enhances tumor clearance in vivo, without affecting the TLR7-NF-kappaB pathway activated by the TLR7 agonist in mouse spleen lymphocytes and bone marrow dendritic cells PMID: 28000738 Up-regulation of TLR7 could eliminate intracellular Mtb through autophagy PMID: 28419514 conclude that VDD promotes tumor growth in the context of Smad3 disruption, potentially through regulation of TLR7 expression and beta-catenin activation PMID: 27456065 activation of TLR7 in the mouse bladder induced cystitis with sensory hyperactivity of the bladder PMID: 28595240 Here, we show that under these circumstances, the Toll-like receptor (TLR)-7/8 ligand imiquimod, but not the TLR3 ligand poly I:C or TLR9 ligand CpG, mediated an effective antitumor response. The rejection of these immune-escaped cancers was mediated by NK cells and CD4(+) T cells, whereas activated CD8(+) T cells were dispensable PMID: 28637878 TLR7 prevents progression of non-alcoholic fatty liver disease via induced autophagy and released IGF-1 from liver. These findings suggest a new therapeutic strategy for the treatment of NAFLD. PMID: 27279075 Toll-like receptor 2 (TLR2) controls random motility, while Toll-like receptor 7 (TLR7) regulates chemotaxis of microglial cells via distinct pathways. Furthermore, TLR7 mRNA expression is down-regulated by TLR2 and TLR7 activation. PMID: 27554518 results provide evidence that G, dG, 8-OHG and 8-OHdG are novel endogenous ligands for TLR7. PMID: 26489884 Virus infection activates endosomal NOX2 oxidase and restricts TLR7 signaling, and that an endosomal NOX2 inhibitor decreases viral pathogenicity. PMID: 28701733 TLR7 deficiency attenuates retinal damage in diabetic retinopathy model. PMID: 28843858 The data demonstrate that an atypical TLR7 signaling pathway contributes to type interferon-beta expression during Y. pestis infection and suggest that the TLR7-driven type I IFN response plays an important role in determining the outcome of plague. PMID: 28847850 Evaluation of the adjuvant effect of agonists of toll-like receptor 4 and 7/8 in a vaccine against leishmaniasis PMID: 28963929 these data demonstrate that extracellular-miRNA mimics (miR-34a, -122, -133a, -142, -146a, and -208a) are potent innate immune activators and that the miRNAs most likely induce cytokine production and leukocyte migration through TLR7 signaling PMID: 28768728 study demonstrates that activation of TLR7 signaling in T cells can inhibit Th17 cell differentiation from naive T cells and IL-17 production in established Th17 cells; further report that downregulation of STAT3 signaling is responsible for TLR7-mediated inhibition of Th17 cells due to induction of suppressor of cytokine signaling 3 and 5 PMID: 28652396 identification of a novel mechanism by which TLR and type I IFN synergize to promote monocyte/macrophage development from hematopoietic progenitors, a process critical in triggering rapid immune responses during infection PMID: 27566824 Notch1-Hes-1 signaling controls TLR7-induced autophagic death of macrophage via regulation of P62 in mice with lupus. PMID: 27537524 Dual TLR2/TLR7 agonist induced the maturation of dendritic cells and primed substantial populations of cytolytic and highly polyfunctional effector CD8(+) T cells in vitro, and safely potentiated the immunogenic properties of a nanoparticulate Ag in vivo, eliciting humoral responses with a balanced TH1/TH2 profile in mice. PMID: 28432147 determine the effects of a loss of autophagy in dendritic cells (DCs), as well as both B cells and DCs, in a TLR7-mediated model of autoimmunity, similar to systemic lupus erythematosus, where both cell types are critical for disease PMID: 28031336 findings show that TLR7 activation significantly promoted interphotoreceptor retinoid-binding protein (IRBP)-specific Th17 responses by upregulating RORgammat, IL-17, GM-CSF, and IL-23R expression in experimental autoimmune uveitis mice. PMID: 27798152 CD72 appears to specifically inhibit B cell response to the endogenous TLR7 ligand Sm/RNP. PMID: 27810925 TLR8 coupling with SOCS-1 inhibits TLR7-mediated antiviral immunity during WNV infection in mice. PMID: 27798161 Azithromycin impairs imiquimod-induced dendritic cell activation by decreasing lysosomal acidification and disrupting TLR7 maturation and signaling. PMID: 27449383 the activation of TLR7 increased CCND3 expression via the downregulation of miR-15b in B cells. PMID: 26144250 this study demonstrates the critical role of Gfi1 in the regulation of myeloid cells, and prevention of spontaneous lupus autoimmunity by negatively controlling TLR7 signaling PMID: 27600904 this study shows that beta,beta-dimethylacryloyl alkannin could inhibit psoriasis-activated dendritic cells via the TLR7/8 pathway PMID: 27697724 Orally administered R848 triggers TLR-7 on CD11c(+) dendritic cells, inducing interleukin-23 (IL-23) expression followed by a burst of IL-22 secretion by innate lymphoid cells, leading to Reg3gamma expression and restoration of colonization resistance against vancomycin-resistant enterococcus. PMID: 26912904 Aging Impairs the Ability of Conventional Dendritic Cells to Cross-Prime CD8+ T Cells upon Stimulation with a TLR7 Ligand. PMID: 26474053 Type I Interferons maintain expression of TLR7 in B cells and conventional dendritic cells in different ways; total amount of TLR7 is kept in B cells and TLR7(+) population is retained among conventional dendritic cells. PMID: 26621862 These data provide direct evidence that B cells require TLR7-dependent priming through an autophagy-dependent mechanism before autoimmunity is induced, thereafter involving many cell types. PMID: 26120731 describe novel roles for type I IFN and TLR7 signaling in nonhematopoietic cells PMID: 26289159 Data show that preconditioning with poly(I:C) alters toll-like receptors (TLR) and RIG-I-like receptors (RLRs) responses in opposite directions. PMID: 26392465 Report chemical conjugation of TLR7 agonist T7 and multi-repeat-epitope of monoclonal gastric cancer 7 antigen exerts antitumor effects. PMID: 26185376 Our data show that TLR7 excess influences the selection, expansion and diversification of B cells in the germinal center, independent of other genes in the Yaa locus. PMID: 25794167 an important role of 2'-O-methylation for shaping differential TLR7 or TLR8 activation PMID: 25785446 Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via MyD88-TLR7 signaling. PMID: 26363072 B-cell intrinsic TLR7 signals promote depletion of the marginal zone in a murine model of Wiskott-Aldrich syndrome. PMID: 26256668 A mucolipin agonist specifically enhanced TLR7 responses to ssRNAs. PMID: 25239130 These studies identify that TLR7 stimulation leads to the expansion of IL-10-producing CD19(+) CD1d(hi) B cells, which can suppress allergic lung inflammation via T regulatory cells. PMID: 25763771 Treatment with Let7c and miR21 restricted dendritic growth of wild-type neurons but not Tlr7(-/-) neurons PMID: 25917529 activation exacerbated lupus nephritis through dendritic and t-regulatory cells PMID: 25341693 TLR8 deletion accelerated autoimmunity in lupus-prone mice in response to TLR7 activation. PMID: 25424423 Inhibition of IDO could enhance the therapeutic efficacy of TLR7 agonists via the increase of T helper type 1 immune response in tumors. PMID: 25322876 Study demonstrates for the first time that influenza A virus and TLR7 activation enhance the NOX2 oxidase-dependent oxidative burst in macrophages. PMID: 24869957 This work identifies signalling through TLR7 as a source of pathology in experimental cerebral malaria. PMID: 25192715 Results suggest that the TLR7 response following Japanese encephalitis virus infection promotes type-1 interferon production and generation of antiviral state which might contribute to protective effect in systemic infection PMID: 24909816 A single copy of TLR7 in B cells is the minimal requirement for breaking the germinal center-tolerance checkpoint. PMID: 25252960 TLR7 activation led to myd88-dependent production of pro-inflammatory cytokines in dystrophin-deficient muscle cells. PMID: 24368419

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.