Recombinant Mouse Thyroid Hormone-Inducible Hepatic Protein (THRSP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09423P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Thyroid Hormone-Inducible Hepatic Protein (THRSP) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09423P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Thyroid Hormone-Inducible Hepatic Protein (THRSP) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q62264 |
Target Symbol | THRSP |
Synonyms | Thrsp; S14; Thyroid hormone-inducible hepatic protein; Spot 14 protein; S14; SPOT14 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL |
Expression Range | 1-150aa |
Protein Length | Full Length |
Mol. Weight | 33.1kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB. |
Subcellular Location | Nucleus. Cytoplasm. |
Protein Families | SPOT14 family |
Database References | KEGG: mmu:21835 STRING: 10090.ENSMUSP00000042988 UniGene: PMID: 24771867 |