Recombinant Mouse Thy-1 Membrane Glycoprotein (THY1) Protein (His-SUMO)

Name: Recombinant Mouse Thy-1 Membrane Glycoprotein (THY1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-03954P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Thy-1 Membrane Glycoprotein (THY1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P01831
Target Symbol	THY1
Synonyms	Thy1; Thy-1; Thy-1 membrane glycoprotein; Thy-1 antigen; CD antigen CD90
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
Expression Range	20-131aa
Protein Length	Full Length of Mature Protein
Mol. Weight	28.8kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Subcellular Location	Cell membrane; Lipid-anchor, GPI-anchor.
Database References	KEGG: mmu:21838 STRING: 10090.ENSMUSP00000110489 UniGene: PMID: 27767183 Results indicate that the close interaction between Thy-1 and Fas in lipid rafts regulates fibroblast apoptosis, and decreased fibroblast apoptosis associated with myofibroblast accumulation in mice lacking Thy-1. PMID: 28165468 Thy-1 in CECs regulates VEGF-induced CEC activation and migration and links extracellular 7-KC to intracellular signaling. PMID: 27768790 lincRNA-p21 overexpression dramatically inhibited acetylation of H3 and H4 at the Thy-1 promoter and Thy-1 expression levels in HLF1 cells. Finally, lincRNA-p21 interference rescued LPS-induced increase of lung and BAL collagen contents. LincRNA-p21 could lead to pulmonary fibrosis in ARDS by inhibition of the expression of Thy-1. PMID: 27392907 The changes in CD90 and CD105 expression in the testis and ovary of mice are reported. PMID: 26679159 Suggest that TGF-beta1 epigenetically regulates lung fibroblast phenotype through methylation of the Thy-1 promoter. PMID: 26333597 Thy-1 facilitates the recruitment of membrane raft-residing signaling molecules such as Fyn kinase and the SFK regulator, Csk binding protein (Cbp), to focal adhesions via its direct coupling of integrins and raft domains. PMID: 26459603 Thy-1 has an important role in controlling cell proliferation and cell differentiation in dermal fibroblasts. PMID: 25739049 TLR4 activation enhances the PD-L1-mediated tolerogenic capacity of colonic CD90+ stromal cells. PMID: 25070848 results indicate that CD90/Thy-1 is expressed on lymphatic endothelial cells and represents a suitable marker for murine lung lymph vessels PMID: 23408960 Thy1-expressing subpopulation of basolateral amygdala pyramidal neurons provide an important molecular and pharmacological target for inhibiting fear PMID: 23785152 These data suggest that blocking Thy-1 at wound areas using siRNA reduces repair and affects the re-epithelialization and over-expression of TGF-beta1 of the wound during the skin healing process. PMID: 23312577 Thy-1 promoter becomes methylated in hypoxic fibroblasts resulting in reduced gene expression and activation of myofibroblast phenotype. PMID: 22938014 Astrocytic alphaVbeta3 integrin inhibits neurite outgrowth and promotes retraction of neuronal processes by clustering Thy-1 PMID: 22479590 Thy-1 promoted lipofibroblast differentiation via the expression of PPARgamma, stimulated lipid accumulation via fatty-acid esterification, and enhanced the fatty-acid uptake mediated by fatty-acid transporter proteins PMID: 22268140 data suggest THY1 plays a role in cell adhesion via binding to integrin beta3 in ovaries; THY1 may be involved in cell-cell adhesion during formation of theca cell layer; induced of THY1 in ovaries may be affected by follicle stimulating hormone PMID: 21228213 During acute lung inflammation, the extravasation of eosinophils and monocytes into the lung was significantly reduced in Thy-1-deficient mice. PMID: 21264853 The machinery of NE/cAMP modulation of Thy-1 mRNA decay involves a cAMP responsive ARE in its 3' UTR and multiple site specific ARE binding proteins. PMID: 20412850 Thy1 is a novel lymphatic vessel expressed gene, and has a potential role in the cell adhesion processes required for tumor progression and inflammation PMID: 20599951 Findings suggest that Thy-1 down-regulates TNF-alpha-activated gene expression via interfering with SFK- and NF-kappaB-mediated transactivation. PMID: 20657842 Thy-1-integrin alpha(v)beta(5) interactions inhibit contraction-induced latent TGF-beta1 activation, presumably by blocking the binding of extracellular matrix-bound latent TGF-beta1 with integrin alpha(v)beta(5). PMID: 20463011 visual signals derived from the rat ChR2-expressing retinal ganglion cells under the control of a mouse Thy-1.2 promotor are reinterpreted by the brain to form behavior-related vision PMID: 19893752 CBP plays a role in transiently anchoring Thy-1 to the cytoskeleton. PMID: 19825940 Thy-1 triggering can partially substitute for signal 1 for T cell activation which, in combination with a strong signal 2, leads to robust T cell proliferation and IL-2 synthesis but does not induce cytolytic function. PMID: 12816984 results indicate that alphaX-beta2 specifically interacts with Thy-1 PMID: 15850796 Thy-1 signalling promotes the in vitro generation of CTL that kill in a granule-dependent fashion PMID: 16033530 Loss of fibroblast Thy-1 expression correlates with lung fibrogenesis PMID: 16049324 CD44(+) CD90(+) cells have the ability to generate neurospheres and to form vascular tubes PMID: 16962069 Thy-1 positive cells have 4-8 times higher potential to show neuron-like morphology and differentiation than Thy-1 negative cells. PMID: 17006052 Thus, CD90(+) cells are a newly identified additional cell fraction that increased during skeletal muscle regeneration in vivo and could be another cell source for therapy for lama2-deficient muscular dystrophy. PMID: 17963748 Epigenetic regulation of Thy-1 is a novel and potentially reversible mechanism in fibrosis that may offer the possibility of new therapeutic options PMID: 18556592 loss of Thy1 can influence the dopaminergic profile in the striatum PMID: 18615641 Thy1 in myofibroblasts is not just a marker, but is a functional protein that transmits signals into the cell, up-regulating its FasL expression. PMID: 18676775 Hypoxia, by reducing Thy-1, increases TGF-beta activation, and thereby inhibits normal alveolar development. PMID: 19270178

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Mouse Thy-1 Membrane Glycoprotein (THY1) Protein (His-SUMO)

Recombinant Mouse Thy-1 Membrane Glycoprotein (THY1) Protein (His-SUMO)

Product Overview

Target Details

FAQs