Recombinant Mouse Tenascin (TNC) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02483P

Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Tenascin (TNC) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-02483P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Tenascin (TNC) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q80YX1 |
Target Symbol | TNC |
Synonyms | Tnc; Hxb; Tenascin; TN; Hexabrachion; Tenascin-C; TN-C |
Species | Mus musculus (Mouse) |
Expression System | Mammalian cell |
Tag | N-10His&C-Myc |
Target Protein Sequence | GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN |
Expression Range | 1884-2099aa |
Protein Length | Partial |
Mol. Weight | 28.8 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Protein Families | Tenascin family |
Database References | KEGG: mmu:21923 UniGene: PMID: 29546590 |