Recombinant Mouse Tenascin (TNC) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10400P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Mouse Tenascin (TNC) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10400P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Tenascin (TNC) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q80YX1
Target Symbol TNC
Synonyms Tnc; Hxb; Tenascin; TN; Hexabrachion; Tenascin-C; TN-C
Species Mus musculus (Mouse)
Expression System Yeast
Tag N-6His
Target Protein Sequence GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Expression Range 1884-2099aa
Protein Length Partial
Mol. Weight 26.8 kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells.
Subcellular Location Secreted, extracellular space, extracellular matrix.
Protein Families Tenascin family
Database References

KEGG: mmu:21923

UniGene: PMID: 29546590

  • Results identify tenascin-C as an endogenous danger signal that is upregulated in systemic sclerosis and drives TLR4-dependent fibroblast activation, and by its persistence impedes fibrosis resolution. PMID: 27256716
  • ATF3 promotes macrophage migration and reverses M1polarized macrophages to the M2 phenotype by upregulation of TNC via the Wnt/betacatenin signaling pathway. PMID: 28714032
  • housing of TnC-/- mice in enriched environment abolished hyperlocomotion, led to faster habituation to novel environment, strengthened the grasp of fore limbs and partially improved movement coordination, while the swimming ability remained deficient PMID: 28549651
  • The synaptic plasticity occurs in the hippocampus of freely behaving mice that lack tenascin-C, the informational content stored by synaptic plasticity is not the same. PMID: 28512860
  • Study suggests that tenascin-C (TnC) contributes to the regulation of structural plasticity in the cerebellum and that interactions between TnC and matrix metalloproteinase 9 are likely to be important for these processes to occur. PMID: 27089885
  • the exact role of TNC in primary tumor growth PMID: 28874093
  • A deficiency of tenascin C interferes with Th1 and Th17 cells, protecting animals from experimental autoimmune encephalomyelitis. PMID: 27974153
  • secreted by transdifferentiated retinal pigment epithelial cells and promotes the development of choroidal neovascularization via integrin alphaV in a paracrine manner PMID: 27668890
  • Tenascin-C may be an important mediator in the development of brain edema and blood-brain barrier disruption following subarachnoid hemorrhage, mechanisms for which may involve MAPK-mediated MMP-9 induction and ZO-1 degradation PMID: 26473781
  • TN-C aggravates autoimmune myocarditis by driving the dendritic cell activation and Th17 differentiation via toll-like receptor 4. PMID: 25376187
  • TNC supports the stress-induced expression of extracellular matrix that reinforce the aorta and the stress-induced excessive inflammatory response in the aorta. PMID: 24514259
  • TNC plays an important role in TMJ wound healing, especially for wounds generated by mechanical stress. PMID: 25578971
  • Tenascin-C is required for normal Wnt/beta-catenin signaling in the whisker follicle stem cell niche. PMID: 25196097
  • TNC downregulates Dickkopf-1 (DKK1) promoter activity through the blocking of actin stress fiber formation, activates Wnt signaling, and induces Wnt target genes in tumor and endothelial cells. PMID: 24139798
  • The increased levels of elastin, type V collagen and tenascin C are probably the result of increased expression by fibroblastic cells; reversely, elastin influences myofibroblast differentiation PMID: 24291458
  • Elevated tenascin-C expression in globoid cell leukodystrophy modified microglial functional response to psychosine. PMID: 25192051
  • Tenascin-C-derived peptide TNIIIA2 highly enhances cell survival and platelet-derived growth factor (PDGF)-dependent cell proliferation through potentiated and sustained activation of integrin alpha5beta1. PMID: 24808173
  • FHL2-deficient mice developed a severe and long-lasting lung pathology due to enhanced expression of tenascin C and impaired activation of inflammation-resolving macrophages. PMID: 24260575
  • the CD34-positive whisker follicle stem cell niche contains both tenascin-C and tenascin-W, and these glycoproteins might play a role in directing the migration and proliferation of these stem cells PMID: 24101721
  • It is upregulated in inflammation and induces further inflammatory responses and the functional inhibition exerts beneficial effects on AD pathogenesis, suggesting a potential for tnc as a new therapeutic target in AD. PMID: 23673309
  • Tenascin C did not play an essential role in stem and progenitor cell homing to BM, but significantly altered lymphoid primed progenitor cell homing PMID: 24084079
  • TNC does not appear to contribute directly to outflow resistance in the eye. PMID: 23882691
  • TNC expression controls eotaxin level in apo E-/- mice; this chemokine plays a key role in the development of atherosclerosis PMID: 23433402
  • This study provided evidence that the tenascin-c modulates synaptogenesis and long-term synapse stability. The mutant neurons display reduced frequencies of mEPSCs and mIPSCs. PMID: 23637166
  • cleavage by gingipains directly affects the biological activity of both fibronectin and tenascin-C in a manner that might lead to increased cell detachment and loss during periodontal disease. PMID: 23313574
  • Tenascin-C enables macrophage translation of proinflammatory cytokines upon lipopolysaccharide activation of toll-like receptor 4 (TLR4) and suppresses the synthesis of anti-inflammatory cytokines. PMID: 23084751
  • These data unveil a protective role for tenascin C (TNC) in atherosclerosis and suggest that TNC signaling may have the potential to reduce atherosclerosis, in part by modulating VCAM-1 expression. PMID: 22300502
  • TNC is involved in the etiopathology of obesity via visceral adipose tissue inflammation representing a link with extracellular matrix remodeling. PMID: 22851489
  • Both cycling G2-phase cells and early post-mitotic neurons were significantly increased in the retina due to Tnc-deficiency. Further investigations suggested that Tnc regulates these processes via the Wnt-signaling cascade. PMID: 22691363
  • This study provided evidence that the tenascin-C affect the repair of the blood-spinal cord barrier repair in soinal cord injury. PMID: 22473292
  • Mice lacking TN-C (TN-C(-/-)) mice showed normal steady-state hematopoiesis; however, they failed to reconstitute hematopoiesis after bone marrow ablation and showed high lethality. PMID: 22553313
  • data establish a role for BMP, Wnts, and mechanical loading in the regulation of tenascin expression in osteoblasts PMID: 21751239
  • Tnc deficiency interfered with VCAM-1 vascular deposition and down-regulation of PECAM-1, disrupted MMP-9-positive leukocyte infiltration, hampered apoptosis and necrosis, and favored liver repair/regeneration after ischemia-reperfusion injury. PMID: 21898491
  • TN-C may be a useful biomarker for indicating the pathological status of smooth muscle cells and interstitial cells in abdominal aortic aneurysm. PMID: 21951663
  • The data implicated tenascin C in the regulation of proliferation and lineage progression of astroglial progenitors in specific domains of the developing spinal cord. PMID: 22071102
  • Data show that reduction in metastasis due to the loss of S100A4(+) fibroblasts correlated with a concomitant decrease in the expression of several ECM molecules and growth factors, particularly Tenascin-C and VEGF-A. PMID: 21911392
  • Promoter-reporter and chromatin immunoprecipitation experiments unraveled a SAP-dependent, SRF-independent interaction of MKL1 with the proximal promoter region of TNC. PMID: 21705668
  • Tenascin-C is expressed in neural stem cells and neural cells derived from embryonic stem cells where it is expected to have a specific functional role in facilitating nervous tissue repair and regeneration. PMID: 20689858
  • Study suggests a new role of tenascin-C as a regulator of the fibrinolytic system. PMID: 21354146
  • Overexpression of TNC-fnD via adeno-associated virus in wild-type mice improved locomotor recovery, increased monaminergic axons sprouting, and reduced lesion scar volume after spinal cord injury. PMID: 20606643
  • HNK-1 epitope-carrying tenascin-C spliced variant regulates the proliferation of mouse embryonic neural stem cells. PMID: 20855890
  • Tenascin-C is required for injury-induced epithelial-mesenchymal transition in the mouse lens epithelium. PMID: 20664686
  • Mechanisms are presented of the first signaling pathways that underlie Tnc-induced, extracellular matrix-dependent maintenance of the immature state of oligodendendrocyte precursor cells. PMID: 20844127
  • Tenascin-C may thus accelerate adverse ventricular remodeling, cardiac failure, and fibrosis in the residual myocardium after myocardial infarction. PMID: 20081106
  • Here we show that periostin, a matricellular protein, promotes incorporation of tenascin-C into the extracellular matrix and organizes a meshwork architecture of the extracellular matrix. PMID: 19887451
  • These findings indicate a role for tenascin-C in structural organization of the CA1 hippocampal subfield and in shaping neural activity. PMID: 19280660
  • results suggested that the isoforms containing one or five alternatively spliced domains play important roles in the healing process of glomerulonephritis PMID: 12009782
  • TN-C is involved in hippocampus-dependent contextual memory and synaptic plasticity; the FN6-8 domain is one of molecular determinants mediating these functions. PMID: 12359159
  • TN-C induces MMP-9 expression directly and by collaboration with TGF-beta in breast cancer progression PMID: 12672030
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed