Recombinant Mouse T-Cell Leukemia/Lymphoma Protein 1A (TCL1A) Protein (His&Myc)

Name: Recombinant Mouse T-Cell Leukemia/Lymphoma Protein 1A (TCL1A) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00170P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse T-Cell Leukemia/Lymphoma Protein 1A (TCL1A) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P56280
Target Symbol	TCL1A
Synonyms	(Oncogene TCL-1)(Oncogene TCL1)(Protein p14 TCL1)
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MATQRAHRAETPAHPNRLWIWEKHVYLDEFRRSWLPVVIKSNEKFQVILRQEDVTLGEAMSPSQLVPYELPLMWQLYPKDRYRSCDSMYWQILYHIKFRDVEDMLLELIDSESNDE
Expression Range	1-116aa
Protein Length	Full Length
Mol. Weight	21.6 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Enhances the phosphorylation and activation of AKT1 and AKT2. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival.
Subcellular Location	Cytoplasm. Nucleus. Microsome. Endoplasmic reticulum.
Protein Families	TCL1 family
Database References	KEGG: mmu:21432 STRING: 10090.ENSMUSP00000036066 UniGene: PMID: 27903679 suggests that in the TCL1-tg mouse, main tumor support may not be derived from CD4+ T cells, but from the monocytic population PMID: 26522084 we revealed that one of the key functions of KLF4-induced TCL1 during reprogramming is to promote the metabolic shift from oxidative phosphorylation to glycolysis. PMID: 28262547 results indicate that decreased Cav-1 in Emu-TCL1 mice significantly delays the onset of CLL and decreases leukemic progression by inhibiting MAPK-Erk signaling, suggesting a role for Cav-1 in the proliferation and progression of CLL PMID: 26435347 This review discusses the main features of the original TCL1 models and the different lines of research successively developed with particular attention to genetically compound mice and the therapeutic applications in drug development. PMID: 25700368 Tcl1 expression downregulated a distinct group of genes, including Ndp52, whose expression is very high in blastocysts but reduced in the primitive ectoderm. PMID: 23940776 Data indicate that APRIL expression accelerates the onset of TCL1-driven leukemia formation mainly through TACI activation. PMID: 24100449 These findings demonstrate cooperation of Tcl1 and the NF-kB pathway in the pathogenesis of aggressive chronic lymphocytic leukemia. PMID: 23591791 An important role of TCL1 in activating the ER stress response in support for malignant progression of chronic lymphocytic leukemia. PMID: 22692508 TCL1 and/or other genes in the TCL1 pathway are responsible for the initiation of human chronic lymphocytic leukemia. PMID: 12011454 role in early embryonic development and overexpression in human seminomas PMID: 12181493 Akt kinase activity can be inhibited by a peptide spanning the betaA strand of the proto-oncogene TCL1 PMID: 15459205 Tcl1 is a coactivator of Akt signaling, in normal T- and B-cell development and function. PMID: 15479728 Detailed mechanism for TCL1-augmented signaling helps explain the delayed occurrence of mature T cell expansions and leukemias despite tumorigenic TCL1 dysregulation that begins in early thymocytes. PMID: 16002684 findings indicate that other oncogenic mechanism(s) may be involved in the development of solid tumors in Emu-TCL1 transgenic mice PMID: 16424025 TCL1 transgenic B cells primed for transformation must experience the germinal center environment and, for at least some, develop genome instability to become fully malignant. PMID: 16728701 Data indicate that the immunoglobulin heavy and light chain rearrangements in TCL1 mice display minimal levels of somatic mutations and exhibit several molecular features found in the human disease. PMID: 16864779 early mouse embryos display a physiological dissociation between TCL1 functions of AKT phosphorylation and phosphorylated AKT transfer to nucleus PMID: 17901877 a ternary complex of TCL1, Epac1, and Akt forms in activated macrophages both promoting Akt activation and regulating intracellular distribution of Akt PMID: 17993260 Tcl1 gene(s) might have important roles in hair formation, by its involvement in cycling and self-renewal of transient amplifying (TA) and stem-cell (SC) populations. PMID: 19169282 infusion of chronic lymphocytic leukemia cells into young Emu-TCL1 mice induced defects comparable to those seen in mice with developed leukemia, demonstrating a causal relationship between leukemia and the T-cell defects PMID: 19332800

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.