Recombinant Mouse Sonic Hedgehog Protein (SHH), Active
Beta LifeScience
SKU/CAT #: BLC-05634P
Greater than 95% as determined by SDS-PAGE.
Recombinant Mouse Sonic Hedgehog Protein (SHH), Active
Beta LifeScience
SKU/CAT #: BLC-05634P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Sonic Hedgehog Protein (SHH), Active is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml. |
| Uniprotkb | Q62226 |
| Target Symbol | SHH |
| Synonyms | Shh; Hhg1; Sonic hedgehog protein; SHH; HHG-1; Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains; ShhNC) [Cleaved into: Sonic hedgehog protein N-product; ShhN; Shh N-terminal processed signaling domains; ShhNp; Sonic hedgehog protein 19 kDa product)] |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
| Expression Range | 25-198aa |
| Protein Length | Partial |
| Mol. Weight | 19.8 kDa |
| Research Area | Cancer |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN. Both activities occur in the reticulum endoplasmic. Once cleaved, ShhC is degraded in the endoplasmic reticulum.; The dually lipidated sonic hedgehog protein N-product (ShhNp) is a morphogen which is essential for a variety of patterning events during development. Induces ventral cell fate in the neural tube and somites. Involved in the patterning of the anterior-posterior axis of the developing limb bud. Essential for axon guidance. Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO. |
| Subcellular Location | Endoplasmic reticulum membrane. Golgi apparatus membrane.; [Sonic hedgehog protein N-product]: Cell membrane; Lipid-anchor. |
| Protein Families | Hedgehog family |
| Database References | KEGG: mmu:20423 STRING: 10090.ENSMUSP00000002708 UniGene: PMID: 28547659 |
