Recombinant Mouse Sex-Determining Region Y Protein (SRY) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04714P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Sex-Determining Region Y Protein (SRY) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-04714P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Sex-Determining Region Y Protein (SRY) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q05738 |
Target Symbol | SRY |
Synonyms | Sry; Tdf; Tdy; Sex-determining region Y protein; Testis-determining factor |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ |
Expression Range | 1-144aa |
Protein Length | Partial |
Mol. Weight | 21.2kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. Involved in different aspects of gene regulation including promoter activation or repression. Binds to the DNA consensus sequence 5'-Constitutes the major isoform, which is necessary and sufficient for initiating male sex determination.; Constitutes a minor isoform, which is unstable due to the presence of a degron at the C-terminus that promotes its degradation. Not necessary and sufficient for initiating male sex determination. |
Subcellular Location | Nucleus speckle. Cytoplasm. Nucleus. |
Protein Families | SRY family |
Database References | KEGG: mmu:21674 STRING: 10090.ENSMUSP00000088717 UniGene: PMID: 28942012 |