Recombinant Mouse Sex-Determining Region Y Protein (SRY) Protein (His)

Name: Recombinant Mouse Sex-Determining Region Y Protein (SRY) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04714P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Sex-Determining Region Y Protein (SRY) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q05738
Target Symbol	SRY
Synonyms	Sry; Tdf; Tdy; Sex-determining region Y protein; Testis-determining factor
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ
Expression Range	1-144aa
Protein Length	Partial
Mol. Weight	21.2kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. Involved in different aspects of gene regulation including promoter activation or repression. Binds to the DNA consensus sequence 5'-Constitutes the major isoform, which is necessary and sufficient for initiating male sex determination.; Constitutes a minor isoform, which is unstable due to the presence of a degron at the C-terminus that promotes its degradation. Not necessary and sufficient for initiating male sex determination.
Subcellular Location	Nucleus speckle. Cytoplasm. Nucleus.
Protein Families	SRY family
Database References	KEGG: mmu:21674 STRING: 10090.ENSMUSP00000088717 UniGene: PMID: 28942012 MAP2K6 functions in mouse testis determination, via positive effects on Sry, and a minor role for MAP2K3. PMID: 27009039 our findings support that males lacking the testis determinant Sry can be fertile and reinforce the notion that Sry does not play a role in mature gonads. PMID: 26536904 Variations in Usp9y and the number of CAG repeats in Sry are significantly associated with testes weight. PMID: 25716571 Sry can be replaced by transgenic activation of its downstream target Sox9. This finding supports the existence of functional redundancy between the Y chromosome genes and their homologs encoded on other chromosomes. PMID: 26823431 SRY binds to various ovarian differentiation genes and represses their activation through WNT/beta-catenin signaling. PMID: 25088423 The SRY gene in plasma extracellular vesicles transferred to vascular endothelial cells may play an important role in the pathogenesis of atherosclerosis PMID: 25783200 Studies indicate that in most of mammals, a single genetic trigger, the Y-linked gene Sry (sex determination region on Y chromosome), regulates testicular differentiation. PMID: 25139092 disprove the hypothesis that the conserved HMG box domain is the only functional domain of Sry, and highlight an evolutionary paradox whereby mouse Sry has evolved a novel bifunctional module to activate Sox9 directly PMID: 25074915 this study demonstrates that live mouse progeny can also be generated by using germ cells from males with the Y chromosome contribution limited to only two genes, the testis determinant factor Sry and the spermatogonial proliferation factor Eif2s3y. PMID: 24263135 Microsatellite-encoded domain in rodent Sry functions as a genetic capacitor to enable the rapid evolution of biological novelty. PMID: 23901118 70-kDa heat shock cognate protein hsc70 mediates calmodulin-dependent nuclear import of the sex-determining factor SRY. PMID: 23235156 Data from knockout mice suggest that spermiogenesis can be initiated whether or not second meiotic division has taken place, and even when the only Y genes present are Sry and Eif2s3y. PMID: 22869781 mice lacking Gadd45gamma also exhibit XY gonadal sex reversal caused by disruption to Sry expression PMID: 23102580 suggest that a signaling cascade, involving GADD45G --> p38 MAPK --> GATA4 --> SRY, regulates male sex determination PMID: 23102581 Data propose that SRY/Sry may function as a male-specific maturation factor in the peri-implantation mammalian embryo. PMID: 22539273 Factor SRY is the key trigger of mammalian sex determination by means of initiation the autosomal gene SOX9 expression. (Review) PMID: 22827036 This study implicates Cbx2 in testis differentiation through regulating Sry gene expression. PMID: 22186409 The results of this study suggest that gender indeed influences several PD-related gene expressions in VM neurons, and SRY and estrogen are involved in the different responses to oxidative stress in culture. PMID: 21919034 Non-CpG methylation occurs in the regulatory region of the Sry gene. PMID: 21636956 Data confirm the importance of SRY (and SRY-calmodulin complex formation) for testis differentiation and sex determination. Transport of SRY to nucleus appears to involve calmodulin. PMID: 21558314 alcohol drinking was predicted by gonadal phenotype independent of sex chromosome complement. These results indicate that different alcoholism-related behaviors are determined independently by gonadal and chromosomal sex. PMID: 20610747 cells expressing Sry induced proliferation of mesonephric cells migrating into male gonads, and inhibited expression of the tissue inhibitor of metalloproteinases (TIMP)-3 gene PMID: 11869290 Gonadal differentiation, sex determination and normal Sry expression in mice require direct interaction between transcription partners GATA4 and FOG2 PMID: 12223418 In testis diferentiation, the center-to-pole Sry expression pattern suggests the regionally distinct potencies of the genital ridge. PMID: 14517996 Levels of progesterone receptors in the anteroventral periventricular nucleus, the medial preoptic nucleus, and the ventromedial nucleus were significantly higher in mice with Sry transgene, regardless of sex chromosomes PMID: 14645115 expression of the Sry gene is under the control of an epigenetic mechanism mediated by DNA methylation PMID: 14978045 SRY protein was detected in the Sertoli cell lineage and was swiftly down-regulated concurrently with testis cord organization PMID: 15789443 the function of SIP-1/NHERF2 as an SRY cofactor during testis determination is conserved between human and mouse PMID: 16166090 Identification of essential sequences of the Sry 5' upstream region that are important for the stage- and tissue-specific expression of Sry. PMID: 16182245 designed a hammerhead ribozyme that could effectively cleave the target Sry mRNA in vitro PMID: 16293944 Sry is specifically expressed in the substantia nigra of the adult male rodent in tyrosine hydroxylase-expressing neurons. PMID: 16488877 Wt1 is located downstream of Sry and down-regulated by the sex determining gene PMID: 16571910 PARP-1 represses Sry-mediated transactivation of a reporter gene in cultured cells. PMID: 16904257 Sry regulation network in the development of male embryo PMID: 18244926 role for KRAB-O and perhaps other KRAB genes in mediating SRY function PMID: 18588511 The present study demonstrates an impact of mouse Sry on Wnt/beta-catenin signaling at an in vitro level. PMID: 18675318 New insights into Sry regulation through identification of 5' conserved sequence are reorted. PMID: 18851760 These results indicate the overarching importance of Sry action in the initial 6-hour phase for the female-to-male switching of FGF9/WNT4 signaling patterns. PMID: 19036799 These results suggest that polymorphism of glutamine repeat within SRY correlates with the appearance of testicular oocyte and this phenotype is derived from AKR, one of the original strains of MRL mice. PMID: 19177742 SRY represses the transcriptional of the Rspo1/Wnt target genes involved in ovarian determination. PMID: 19376480 WT1(+KTS) is involved in the cell-autonomous regulation of Sry expression, which in turn influences cell proliferation and Sertoli cell differentiation via FGF9. PMID: 19549635 The KRAB-O protein can simultaneously bind KAP1 and SRY in a noncompetitive but also noncooperative manner. PMID: 19850934 This study shows that Sry expression in the B6.Ydom sex reversed mice is delayed during sex determination. It suggests that Sry must mediate its sex determining function in a critial window during mouse embryogenesis. PMID: 15789443 Sry protein in the fetal gonads at the time of sex determination has first been demonstrated by western blotting and immmunostaining. PMID: 15789443 A mechanism of chromatin modeling role of Sry is proposed for its function in sex determination. PMID: 16414182 The Sry promoters from domesticus (Tirano) and C57BL/6 mice function similarly in embryonic and adult testes of transgenic mice. PMID: 11748612

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.