Recombinant Mouse Serine/Threonine-Protein Kinase Stk11 (STK11) Protein (His&Myc)

Name: Recombinant Mouse Serine/Threonine-Protein Kinase Stk11 (STK11) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-08649P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Serine/Threonine-Protein Kinase Stk11 (STK11) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9WTK7
Target Symbol	STK11
Synonyms	Stk11; Lkb1; Serine/threonine-protein kinase STK11; EC 2.7.11.1; Liver kinase B1 homolog; LKB1; mLKB1
Species	Mus musculus (Mouse)
Expression System	Baculovirus
Tag	N-10His&C-Myc
Target Protein Sequence	MDVADPEPLGLFSEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPGNLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCGPPLSDLLRGMLEYEPAKRFSIRQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEEEEEEDLFDIEDGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGTANPARKVCSSNKIRRLSAC
Expression Range	1-433aa
Protein Length	Full Length
Mol. Weight	52.9 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, thus promoting their activity: phosphorylates PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3 and SNRK but not MELK. Also phosphorylates non-AMPK family proteins such as STRADA, PTEN and possibly p53/TP53. Acts as a key upstream regulator of AMPK by mediating phosphorylation and activation of AMPK catalytic subunits PRKAA1 and PRKAA2 and thereby regulates processes including: inhibition of signaling pathways that promote cell growth and proliferation when energy levels are low, glucose homeostasis in liver, activation of autophagy when cells undergo nutrient deprivation, and B-cell differentiation in the germinal center in response to DNA damage. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton. Required for cortical neuron polarization by mediating phosphorylation and activation of BRSK1 and BRSK2, leading to axon initiation and specification. Involved in DNA damage response: interacts with p53/TP53 and recruited to the CDKN1A/WAF1 promoter to participate in transcription activation. Able to phosphorylate p53/TP53; the relevance of such result in vivo is however unclear and phosphorylation may be indirect and mediated by downstream STK11/LKB1 kinase NUAK1. Also acts as a mediator of p53/TP53-dependent apoptosis via interaction with p53/TP53: translocates to the mitochondrion during apoptosis and regulates p53/TP53-dependent apoptosis pathways. Regulates UV radiation-induced DNA damage response mediated by CDKN1A. In association with NUAK1, phosphorylates CDKN1A in response to UV radiation and contributes to its degradation which is necessary for optimal DNA repair.; Has a role in spermiogenesis.
Subcellular Location	Nucleus. Cytoplasm. Membrane. Mitochondrion.; [Isoform 2]: Nucleus. Cytoplasm.
Protein Families	Protein kinase superfamily, CAMK Ser/Thr protein kinase family, LKB1 subfamily
Database References	KEGG: mmu:20869 STRING: 10090.ENSMUSP00000003152 UniGene: PMID: 30296566 Data show that that the lineage switching of KRAS+ lung adenocarcinomas (ADC) to squamous cell carcinoma (SCC) through deletion of liver kinase B1 Lkb1 (Stk11). PMID: 28387316 The role of Stk11 in chondrocyte. PMID: 30107230 these data argue for a more complex role for Stk11 mutations in Peutz-Jeghers syndrome development, with deregulated inflammatory responses by LKB1 mutant immune cells, in addition to epithelial and stromal tissues, reinforcing tumor inflammation and chronic STAT3 activation to drive polyp growth. PMID: 30049881 Deletion of Lkb1 results in a cytoplasm to nuclear translocation of CRTC3 in brown adipocytes, where it recruits C/EBPbeta to enhance Ucp1 transcription. PMID: 27461402 The Stk11knockout mice develop prostatic hyperplasia with bladder outlet obstruction, most likely because of stromal expansion. PMID: 28289208 Regulatory T cells lacking Lkb1 have defective mitochondria, compromised OXPHOS, depleted cellular ATP, and altered cellular metabolism pathways that compromise their survival and function. PMID: 29109251 Identification of a new transcript variant Stk11N which is generated through alternative splicing. The new variant was found to have differential and tissue specific expression at Postnatal-7 and adult stages of mouse. PMID: 29777910 This study supports different roles of Lkb1 isoforms in spermatogenesis with Lkb1L directing spermatogonial stem/progenitor cell maintenance, and Lkb1L and Lkb1S coordinately regulating spermatid differentiation. PMID: 29022902 Metabolomics analysis suggests that Lkb1 mutant kidneys require glutamine and glutathione metabolism. PMID: 29483507 These results demonstrate that Lkb1 plays an important role in maintaining body weight, liver and adipose tissue function, blood glucose homeostasis and survival in adult mice. PMID: 27824128 The metabolic effects were associated with activation of the SIRT1-LKB1-AMPK signalling pathway in adipose tissue and liver. PMID: 28493443 Treg cells use LKB1 signalling to coordinate their metabolic and immunological homeostasis and to prevent apoptotic and functional exhaustion, thereby orchestrating the balance between immunity and tolerance PMID: 28847007 renal proximal tubule cell CB1R contributes to the pathogenesis of obesity-induced renal lipotoxicity and nephropathy by regulating the liver kinase B1/AMP-activated protein kinase signaling pathway PMID: 28860163 Results reveal an important role for Lkb1 in regulating cerebellar cortical size and foliation in a Hedgehog-independent manner. PMID: 28974424 beige adipocyte renaissance was governed by liver kinase b1 and histone deacetylase 4 in white adipocytes. PMID: 28882900 miR-17-92-dependent tuning of LKB1 levels regulates both the metabolic potential of Myc+ lymphomas and tumor growth in vivo. PMID: 27498867 Findings indicate that the energy-sensing LKB1-AMPK pathway regulates IGF1 secretion in mouse primary hepatocytes, which in turn regulates activation of the IGF1R-PKB pathway. PMID: 28500773 These data suggest that nutrient availability dictates the mode of division and that LKB1-AMPK mediates this nutrient-driven effect on intestinal epithelial stem cell proliferation. PMID: 28766983 this study identified the molecular mechanism of increased angiogenesis and tumor growth with LKB1 deficiency PMID: 28346429 These results suggest that although physiologic LKB1 expression exerts a potent pro-survival effect in lymphocytes, LKB1 inactivation nonetheless facilitates transformation of B, but not T, lymphocytes. PMID: 28435024 These results suggest that the LKB1-AMPK-FoxO1 signaling pathway is a critical mediator of the antioxidant properties of H2, further supporting the idea that H2 acts as a signaling molecule to serve various physiological functions. PMID: 28743498 Lkb1 activates the Notch signaling pathway, which subsequently increases Pax7 expression and promotes self-renewal and proliferation while inhibiting differentiation. Mechanistic studies reveal that Lkb1 regulates Notch activation through AMPK-mTOR pathway in myoblasts. PMID: 27131604 mitochondrial dysfunction triggers LKB1-mediated AMPK activation, which stimulates Sirt2 phosphorylation, leading to activation of mTOR-RAPTOR and Glut1-mediated glucose uptake. PMID: 27793977 these data demonstrated that LKB1/AMPK signaling pathway activation improved the survival of diabetic mice complicated with endotoxemia. Thus, LKB1/AMPK signaling pathway may serve as a potentially useful therapeutic target for severe infection in diabetic patients. PMID: 28628912 Data show that the serine/threonine kinase LKB1 regulates mitochondrial calcium uniporter (MCU)-expression, mitochondria-dependent Ca2+ clearance, and thereby, presynaptic release properties. PMID: 27429220 LKB1 deficiency in LKB1(Pax2) CKO mice disrupted hair cell planar polarity during embryonic development. The results suggest that LKB1 is required in planar cell polarity formation in cochlear hair cells in mice. PMID: 27896618 silencing of the LKB1 tumor suppressor affects the delamination of pre-migratory cephalic neural crest cells from the neural primordium as well as their polarization and survival, thus resulting in severe facial and brain defects PMID: 27527806 LKB1 complex proteins have a role in myofilament function and myocellular "energy" sensing in the heart PMID: 26971467 identification of a network linking metabolic and epigenetic alterations that is central to oncogenic transformation downstream of the liver kinase B1 (LKB1, also known as STK11) tumour suppressor, an integrator of nutrient availability, metabolism and growth PMID: 27799657 The lack of LKB1 in skeletal muscle leads to an increased inflammatory state. PMID: 26796753 Partial deficiency of cardiac LKB1 promotes the adverse effects of a high-fat, high-sucrose diet on the myocardium, leading to worsening of diastolic function and the de novo appearance of systolic dysfunction. PMID: 26722122 Rapid activation of AMPK was detected after exposure of cortical neuronal cultures to zinc, which was induced by LKB1 activation but not increased intracellular AMP levels or CaMKKbeta activation. PMID: 26856538 LKB1 deletion causes early changes in atrial channel expression and electrophysiology prior to atrial fibrillation. PMID: 26378152 LKB1 promotes maturation of bile ducts during biliary morphogenesis.LKB1 and Notch share a common genetic program in the liver, and regulate bile duct morphogenesis. PMID: 26689699 STK11/LKB1-inactivating mutations were associated with reduced expression of PD-1 ligand PD-L1 in mouse and patient tumors as well as in tumor-derived cell lines. PMID: 26833127 activation of AKT and mTORC1, the double knockout of PTEN and LKB1 contributes to distinct cell-specific aspects of tumor development and progression. PMID: 26329580 we show that loss of LKB1 in renal tubular epithelial cells has an important role in kidney disease development by influencing intracellular metabolism PMID: 26054542 The LKB1 K178R SUMO mutant had defective AMPK signaling and mitochondrial function, inducing death in energy-deprived cells. PMID: 26212320 data indicates that LKB1 is required for the development and maintenance of stereocilia in the inner ear. PMID: 26274331 LKB1 mediates CDKN1A degradation in response to ultraviolet DNA damage. PMID: 25329316 There was an inverse relationship between DEC1 expression and AMPK activity. Our results suggest that DEC1 negatively regulates AMPK activity via LKB1 PMID: 26498531 data reveal cell intrinsic and surprising cell extrinsic roles for LKB1 in B cells that control T follicular helper-cell differentiation and germinal center formation, and place LKB1 as a central regulator of T-cell-dependent humoral immunity PMID: 25916856 LKB1 KO mice develop spontaneous atrial fibrillation from sinus rhythm and progress into persistent AF, replicating the human AF disease process. PMID: 25773299 heterozygous loss of Cdh1 exacerbates the number of extrusions per blastocyst, suggesting that LKB1 has a role in regulating adherens junctions in order to prevent extrusion in epithelia. PMID: 25588837 LKB1 is essential for mitochondrial maintenance and negatively regulates a distal step of insulin secretion. PMID: 26139601 Lkb1-deficient lung adenocarcinoma progressively transdifferentiates into squamous cell carcinoma. PMID: 24531128 loss of LKB1 expression be considered a marker for metabolic dysfunction given its role in regulating AMPK and mTOR function. PMID: 25436981 Sik1, Sik2, and Sik3 play a key role as gluconeogenesis suppressors downstream of LKB1 in the liver. PMID: 25088745 Phosphorylation of LKB1 establishes Schwann cell polarity to initiate myelin extent. PMID: 25255972

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Mouse Serine/Threonine-Protein Kinase Stk11 (STK11) Protein (His&Myc)

Recombinant Mouse Serine/Threonine-Protein Kinase Stk11 (STK11) Protein (His&Myc)

Product Overview

Target Details

FAQs