Recombinant Mouse Serine Protease 29 (PRSS29) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-08038P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Serine Protease 29 (PRSS29) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-08038P
Collections: Fc receptors, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Serine Protease 29 (PRSS29) Protein (His-B2M) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q99MS4 |
Target Symbol | PRSS29 |
Synonyms | Prss29; Isp2; Serine protease 29; EC 3.4.21.-; Implantation serine proteinase 2; ISP-2; Strypsin-2; Strypsin-related protein; Tryptase-like proteinase |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His-B2M |
Target Protein Sequence | GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDAGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS |
Expression Range | 18-279aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 43.1 kDa |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Involved in embryo hatching and implantation. |
Subcellular Location | Secreted. Note=Secretion into the glandular and uterine lumen may occur as a consequence of progesterone-induced epithelial differentiation. |
Protein Families | Peptidase S1 family |
Database References | |
Tissue Specificity | Expressed in embryos and placenta. Found in uterus especially in glandular epithelium during zona lysis and implantation. |
Gene Functions References
- Hypothyroidism induces a significant reduction of proteases Isp1 and Isp2 gene expression and Notch signaling. PMID: 28993437
- ISP2 is a monomeric enzyme with mixed serine proteolytic activity and can silence signaling via proteinase activated receptors. PMID: 24219291
- ISP2 may play an important role during embryo implantation. PMID: 15304212
- ISP2 plays a critical role in embryo hatching and implantation PMID: 17156484
- analysis of two rat genes registered in GenBank, accession nos. XM_220240 and XM_577076, exhibited high identities to the mouse ISP2 genes, at an mRNA level PMID: 18831529