Recombinant Mouse Serglycin (SRGN) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00339P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Serglycin (SRGN) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00339P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Serglycin (SRGN) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P13609 |
| Target Symbol | SRGN |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | C-6His |
| Target Protein Sequence | EGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPTDESNIVYFNYKPFDRILTEQNQDQPEDDFII |
| Expression Range | 75-152aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 15.3 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization. |
| Subcellular Location | Cytoplasmic granule. Cytolytic granule. Secreted, extracellular space. Golgi apparatus. |
| Protein Families | Serglycin family |
| Database References | KEGG: mmu:19073 STRING: 10090.ENSMUSP00000020271 UniGene: PMID: 29588174 |
