Recombinant Mouse Sclerostin (SOST) Protein (His&Myc)

Name: Recombinant Mouse Sclerostin (SOST) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01365P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Sclerostin (SOST) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q99P68
Target Symbol	SOST
Species	Mus musculus (Mouse)
Expression System	Baculovirus
Tag	N-10His&C-Myc
Target Protein Sequence	QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
Expression Range	24-211aa
Protein Length	Full Length of Mature Protein
Mol. Weight	25 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Protein Families	Sclerostin family
Database References	KEGG: mmu:74499 STRING: 10090.ENSMUSP00000001534 UniGene: PMID: 30041240 Since adipocytes do not produce sclerostin, these findings suggest an unexplored endocrine function for sclerostin that facilitates communication between the skeleton and adipose tissue. PMID: 29229807 A microtubule-dependent mechanotransduction pathway that linked fluid shear stress to reactive oxygen species and calcium (Ca2+) signals that led to a reduction in sclerostin abundance in cultured osteocytes. PMID: 29162742 osteoclast-derived LIF regulates bone turnover through sclerostin expression. PMID: 28543818 our study provided histological evidences that sclerostin tends to be secreted in osteocytes of remodeled mature bone, while FGF23 would be differently synthesized in osteoblasts and osteocytes according to the developmental stages PMID: 28794403 These results show that osteocytes and/or osteoblasts secrete factors regulating beige adipogenesis, at least in part, through the Wnt-signaling inhibitor sclerostin. PMID: 27653320 In vivo muCT analysis of cortical bone at age 1 and 3 months confirmed increased thickness in Sost-/-mice, but revealed no cortical abnormalities in single Gja1+/-or Sost+/-mice PMID: 29149200 loss of BMP signaling specifically in osteocytes dramatically increases bone mass presumably through simultaneous inhibition of RANKL and SOST, leading to osteoclast inhibition and Wnt activation together. PMID: 27402532 humanized Multiple Myeloma xenograft mouse model bearing human MM cells (NOD-SCID.CB17 male mice injected intravenously with 2.5 million of MM1.S-Luc-GFP cells) demonstrated significantly higher concentrations of mouse-derived sclerostin, suggesting a microenvironmental source of sclerostin. PMID: 26763740 Protection From Glucocorticoid-Induced Osteoporosis by Anti-Catabolic Signaling in the Absence of Sost/Sclerostin PMID: 27163932 Osteocyte-derived molecule sclerostin drives bone marrow adipogenesis. PMID: 28460416 complete absence of sclerostin has only minor effects on chronic kidney disease-induced bone loss in mice. PMID: 27528549 In mice, sclerostin deficiency hastened reparative dentinogenesis after pulp injury, suggesting that the inhibition of sclerostin may constitute a promising therapeutic strategy for improving the healing of damaged pulps. PMID: 28571484 These data suggest that sclerostin plays an important role in the bone remodeling of tooth movement. PMID: 28081119 Sclerostin inhibits angiotensin II-induced aortic aneurysm and atherosclerosis via wnt signaling pathway inhibition. PMID: 28062506 Analysis of SOST expression using large minigenes reveals the MEF2C binding site in the evolutionarily conserved region (ECR5) enhancer mediates forskolin, but not 1,25-dihydroxyvitamin D3 or TGFbeta1 responsiveness. PMID: 26361013 removal of sclerostin appears to modestly protect the alveolar bone from resorption in this experimental setting PMID: 27349550 chronic TNFalpha (tumor necrosis factor alpha)-dependent arthritis, fibroblast-like synoviocytes constitute a major source of sclerostin and that either the lack of sclerostin or its antibody-mediated inhibition leads to an acceleration of rheumatoid arthritis (RA)-like disease. PMID: 27089204 Data show that the phenotype of Notch activation in osteocytes was prevented in matrix protein 1 (Dmp1)-Cre;Rosa(Notch) mice hemizygous for the Dmp1-sclerostin (SOST) transgene. PMID: 26456319 Results found that sclerostin enhances adipocyte differentiation in 3T3-L1 cells and reduced TAZ-responsive transcriptional activity and TAZ-responsive gene expression, indicating a role for TAZ as a regulator of adipogenesis by sclerostin. PMID: 26553151 Our results suggested that sclerostin could be expressed in the liver and sustained successfully at high levels in the blood by using the PhiC31 integrase system, leading to trabecular bone loss. PMID: 26845353 Sclerostin depletion enhances tibial fracture healing. PMID: 26608966 SOST gene is involved in the regulation of renal interstitial fibrosis (RIF) progression. In obstructive kidney injury, SOST gene deletion would probably enhance renal fibrogenic response and promote the progression of RIF. PMID: 26337453 Data (including data from studies in knockout/transgenic mice) suggest that Lrp6 (lipoprotein receptor-related protein 6) is required for suppression of Sost expression by parathyroid hormone (here, human PTH peptide 1-34). PMID: 25847683 These in vivo data support in vitro studies regarding the mechanism of HBM-causing mutations, and imply that HBM LRP5 receptors differ in their relative sensitivity to inhibition by SOST and DKK1. PMID: 25808845 These findings indicated that AMPK regulated RANKL and sclerostin expression through the mevalonate pathway in osteocytes. PMID: 26713363 Sclerostin inhibits bone formation through Lrp5 interaction. PMID: 25640331 thyroid hormone-induced changes in bone remodeling are associated with a divergent regulation of DKK1 and sclerostin PMID: 26218891 increased sclerostin production achieved by HDAC5 shRNA is abrogated by simultaneous knockdown of MEF2C, indicating that MEF2C is a major target of HDAC5 in osteocytes PMID: 25271055 sclerostin is regulated by glutathione, N-acetylcysteine and lipoic acid in osteocytes in a process involving JNK and ERK1/2 PMID: 25660312 Estrogen replacement treatment in ovariectomized ER beta KO mice caused a significant increase in Col2 expression, no change in ER alpha expression, and a significant increase in Sost expression. PMID: 25046534 Simulated microgravity induces an autonomous up-regulation of sclerostin. PMID: 25953900 deleting the Sost gene (a potent inhibitor of WNT signaling) or blocking sclerostin function by using the mAb in a periodontitis model significantly restores bone and periodontal ligament defects PMID: 25757567 bony union was not altered by Sclerostin deficiency in externally-fixed closed tibial fractures, but fibrocartilage removal was enhanced and the resultant united bony calluses had increased bone fraction and increased strength. PMID: 25445453 Advanced glycation end products increased sclerostin as well as apoptosis, and decreased RANKL in osteocytes. PMID: 25721666 long-term Sclerostin deficiency inhibits the bone loss normally induced with decreased mechanical load, but it can augment the increase in bone formation with increased load. PMID: 24821585 Findings strongly suggest that Wise and Sost are key modulators of bone development through the ability of their encoded proteins to interact with Lrp5 and control the balance or levels of Wnt signaling. PMID: 24789067 the altered bone composition contributes to the increased bone strength of patients with sclerostin deficiency. PMID: 24753092 Data indicate that both Dickkopf-1 (DKK1) and sclerostin (SOST) were downregulated in proteoglycan-induced spondylitis (PGISp)-affected mouse spines. PMID: 23171658 Data indicate that LRP4 (low-density lipoprotein receptor-related protein 4) deficiency in bone dramatically elevated serum sclerostin levels whereas bone expression of Sost encoding for sclerostin was unaltered. PMID: 25404300 importance of the flexible loop and the cystine-knot for Wnt-signaling inhibition PMID: 24312339 Evidence is accumulating that sclerostin directly or indirectly reduces renal calcium reabsorption [review]. PMID: 24876121 Data indicate that low-dose parathyroid hormone (PTH) decreased the expression of the myocyte enhancer factor 2C (Mef2c) transcription factor, resulting in decreased sclerostin (Sost) expression in osteoblasts/osteocytes. PMID: 25056116 Ovariectomy resulted in a substantial decrease in skeletal Sirt1 expression accompanied by an increase in sclerostin. PMID: 24949665 results suggest that the lack of sclerostin mainly alters the bone and cementum phenotypes rather than producing abnormalities in tooth structures such as dentin PMID: 24699186 Data indicate that sclerostin blockade restored bone mineral density (BMD) and bone volume fraction at all assessed sites but was unable to repair focal erosions. PMID: 24432364 In the absence of LRP5, the anabolic effects of SOST depletion can occur via other receptors (such as LRP4/6) PMID: 24225945 sclerostin upregulated osteocyte expression of carbonic anhydrase 2. PMID: 23737439 these data indicate that enhanced beta-catenin signaling is present in Sost(-/-) mice that demonstrate accelerated healing of bone defects, suggesting that modulation of beta-catenin signaling in bone could be used to promote fracture repair. PMID: 24211207 These results support a model in which, in the context of obesity or other inflammatory diseases that increase the production of TNF-alpha, TNF-alpha upregulates the expression of sclerostin through NF-kappaB signaling pathway, thus contributing to bone loss. PMID: 24446199

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.