Recombinant Mouse Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05758P
Recombinant Mouse Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05758P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Retinol-Binding Protein 4 (RBP4) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC 50 is 38.07-75.83 ng/mL. |
| Uniprotkb | Q00724 |
| Target Symbol | RBP4 |
| Synonyms | (Plasma retinol-binding protein)(PRBP)(RBP) |
| Species | Mus musculus (Mouse) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Target Protein Sequence | ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL |
| Expression Range | 19-201aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 50.3 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues. Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane. |
| Subcellular Location | Secreted. |
| Protein Families | Calycin superfamily, Lipocalin family |
| Database References | KEGG: mmu:19662 STRING: 10090.ENSMUSP00000025951 UniGene: PMID: 28849085 |
