Recombinant Mouse Regenerating Islet-Derived Protein 3-Gamma (REG3G) Protein (His)

Name: Recombinant Mouse Regenerating Islet-Derived Protein 3-Gamma (REG3G) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10732P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Regenerating Islet-Derived Protein 3-Gamma (REG3G) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O09049
Target Symbol	REG3G
Synonyms	Reg3g; Pap3; Regenerating islet-derived protein 3-gamma; REG-3-gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma) [Cleaved into: Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regenerating islet-derived protein 3-gamma 15 kDa form]
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
Expression Range	27-174aa
Protein Length	Partial
Mol. Weight	20.3kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.
Subcellular Location	Secreted. Cytoplasm.
Database References	KEGG: mmu:19695 STRING: 10090.ENSMUSP00000032089 UniGene: Mm.252385
Tissue Specificity	Predominantly expressed in the small intestine, including Paneth cells (at protein level). Hardly detectable in the colon (at protein level). Highly expressed in the lung epithelium during methicillin-resistant S.aureus infection (at protein level). Skin

Gene Functions References

the secretion of regenerating islet-derived IIIgamma (RegIIIgamma) is responsible for the protective effect of Adipose-derived stem cells. PMID: 26866937
The study shows that cardiac stress activates Reg3gamma expression and p38 MAPK is an upstream regulator of Reg3gamma gene expression in heart. Altogether the data suggest Reg3gamma is associated with cardiac inflammatory signaling. PMID: 27798352
regenerating islet-derived gene gamma promotes beta cell regeneration and preserves beta cells from autoimmunity damage by increasing regulatory T cell differentiation and inducing tolerated dendritic cells. PMID: 26667474
Recombinant IFN-I or IFN-I expression induced by RIG-I promoted growth of intestinal organoids in vitro and production of the antimicrobial peptide regenerating islet-derived protein 3 gamma (RegIIIgamma). PMID: 28424327
REG3gamma-deficient mice have altered mucus distribution and increased mucosal inflammatory responses to the microbiota and enteric pathogens in the ileum. PMID: 24345802
antibacterial function for lung epithelium through Stat3-mediated induction of Reg3gamma. PMID: 23401489
Reg-IIIgamma expression is mainly observed in epithelial cells of the airways and intestine, but not in the nervous system; expression levels show a gradually increasing pattern along with development. PMID: 21681751
Letter: aggregation status of PAP1 and PAP2 could change their role in regulating the inflammation in acute pancreatitis. PMID: 21926556
findings show that RegIIIgamma is essential for maintaining a ~50-micrometer zone that physically separates the microbiota from the small intestinal epithelial surface PMID: 21998396
findings show that RegIIIgamma and its human counterpart, HIP/PAP, are directly antimicrobial proteins that bind their bacterial targets via interactions with peptidoglycan carbohydrate PMID: 16931762
antibacterial activities of mouse RegIIIgamma and its human ortholog, HIP/PAP, are tightly controlled by an inhibitory N-terminal prosegment that is removed by trypsin in vivo. PMID: 19095652

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.