Recombinant Mouse Protein Wnt-7B (WNT7B) Protein (His-SUMO&Myc)

Name: Recombinant Mouse Protein Wnt-7B (WNT7B) Protein (His-SUMO&Myc)
Brand: Beta LifeScience
SKU: BLC-04005P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Wnt7b.

Collections: High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Protein Wnt-7B (WNT7B) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P28047
Target Symbol	WNT7B
Synonyms	Wnt7b; Wnt-7b; Protein Wnt-7b
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His-SUMO&C-Myc
Target Protein Sequence	ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
Expression Range	25-349aa
Protein Length	Full Length of Mature Protein
Mol. Weight	56.3 kDa
Research Area	Stem Cells
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway. Required for normal fusion of the chorion and the allantois during placenta development. Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation.
Subcellular Location	Secreted, extracellular space, extracellular matrix. Secreted.
Protein Families	Wnt family
Database References	KEGG: mmu:22422 STRING: 10090.ENSMUSP00000105051 UniGene: PMID: 28392344 In a mouse model of myopia, there was downregulation of WNT7B expression in the cornea and upregulation in the retina, suggesting its possible role in the development of myopia. PMID: 25823570 Wnt7b is required for epithelial progenitor growth and operates during epithelial-to-mesenchymal signaling in pancreatic development. PMID: 25576928 Transgenic Wnt7b overexpression in neural progenitor cells impairs neuronal differentiation and the development of forebrain structures at embryonic day 10.5. It decreased expression of Tbr1 and Tbr2, in both progenitor cells and post-mitotic neurons. PMID: 24953933 These findings demonstrate the importance of intrinsic Wnt7b expression in hfSCs regulation and normal HF cycling PMID: 24222445 Stable ectopic expression of Wnt-7b in OSCC cells overexpressing miR329 or miR410 restored proliferation and invasion capabilities abolished by these miRNA PMID: 25351956 Results illustrated the critical role of myeloid WNT7B in tumor progression, acting at the levels of angiogenesis, invasion, and metastasis. PMID: 24638982 Thus, WNT7B promotes bone formation in part through mTORC1 activation. PMID: 24497849 Wnt7b preserves endothelial phenotype in aortic endothelial cells. PMID: 23685555 Epithelial Wnt7b and Wnt9b as possible ligands of Fzd1-mediated beta-catenin (Ctnnb1)-dependent (canonical) Wnt signaling in the undifferentiated ureteric mesenchyme. PMID: 22833126 Dkk1 controls the degree of Wnt-7b signalling in the papilla to coordinate kidney organogenesis. PMID: 21354128 Because Wnt7b is known to stimulate epithelial responses during kidney development, these findings suggest that macrophages are able to rapidly invade an injured tissue and reestablish a developmental program that is beneficial for repair and regeneration PMID: 20160075 promoter is regulated by TTF-1, GATA6, and Foxa2 in lung epithelium PMID: 11914369 Wnt7b signaling is required for proper lung mesenchymal growth and vascular development PMID: 12361974 Data demonstrate that Wnt7b signals through Fzd1 and -10 and LRP5 and implicate these Wnt coreceptors in the regulation of lung airway and vascular development. PMID: 15923619 macrophage WNT7b is a short-range paracrine signal required for WNT-pathway responses and programmed cell death in the vascular endothelial cells of the temporary hyaloid vessels of the developing eye PMID: 16163358 Wnt7b signals to neighboring cells to activate both autocrine and paracrine canonical Wnt signaling cascades. In contrast to results from hypomorphic models, Wnt7b modulates several important signaling pathways in the lung. PMID: 18367557 These findings demonstrate that Wnt7b is a key regulator of the tissue architecture that establishes a functional physiologically active mammalian kidney. PMID: 19060336 alpha3beta1 integrin, a major laminin receptor, and c-Met, the receptor for hepatocyte growth factor, signal coordinately to regulate the expression of Wnt7b in the papilla of the developing kidney PMID: 19176588 Wnt7b regulates a program of mesenchymal differentiation in the lung that is essential for SMC development. PMID: 19690384

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.