Recombinant Mouse Protein S100-A9 (S100A9) Protein (His-SUMO)

Name: Recombinant Mouse Protein S100-A9 (S100A9) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-10017P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Protein S100-A9 (S100A9) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P31725
Target Symbol	S100A9
Synonyms	S100a9; Cagb; Mrp14; Protein S100-A9; Calgranulin-B; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Expression Range	2-113aa
Protein Length	Full Length of Mature Protein
Mol. Weight	28.9kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif.
Subcellular Location	Secreted. Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein.
Protein Families	S-100 family
Database References	KEGG: mmu:20202 STRING: 10090.ENSMUSP00000070842 UniGene: Mm.2128

Gene Functions References

These results suggest that immunological functions of MRP14, and possibly also the associated molecule MRP8, are different between BALB/c and C57BL/6 mice, at least in the response to LPS. PMID: 29253495
the biologically potent dimeric form of S100A9 is induced in vivo in situations of tumor burden or inflammatory challenge. PMID: 29679568
findings reveal unexpected gene expression differences between WT and KO mice at a young age (in the absence of physiological stress), and address the hypothesis that Mrp8 and Mrp14 accumulation promotes age-related inflammation PMID: 27224926
An excessive expansion of monocytic-myeloid-derived suppressor cells in S100A9-/- neonates compared to wild-type neonates. This strong baseline expansion was associated with hyperinflammatory responses during endotoxemia and fatal septic courses PMID: 27993995
Data support a role of S100A9 to initiate and amplify the neutrophilic inflammation in asthma, possibly via inducing IL-1beta, IL-17 and IFN-gamma. PMID: 28847516
S100A9 knockdown almost completely abrogated the effects of IRF7 deletion on granulocytic myeloid-derived suppressor cells development and tumor metastasis. PMID: 28092673
vitro studies on the mechanisms/pathways involved in leukemic cell differentiation revealed that binding of S100A9 to Toll-like receptor 4 (TLR4) promotes activation of p38 mitogen-activated protein kinase, extracellular signal-regulated kinases 1 and 2, and Jun N-terminal kinase signaling pathways, leading to myelomonocytic and monocytic AML cell differentiation. PMID: 28137827
these results indicate that CD14 is a co-receptor of TLR4 in the S100A9-induced cytokine response. PMID: 27228163
Mechanistic studies showed that in MDSCs, ATF3 was transrepressed by the GC receptor GR through direct binding to the negative GR-response element. S100A9 is the major transcriptional target of ATF3 in Granulocytic Myeloid-derived Suppressor Cells. PMID: 27573240
CHI3L1-mediated cell proliferation/survival involves partial downregulation of the pro-apoptotic S100A9 protein that is highly expressed during the acute phase of colitis, by binding to the S100A9 receptor, RAGE (Receptor for Advanced Glycation End products). PMID: 26431492
MRP8/14 serves in an unexpected protective role for the lung in staphylococcal pneumonia. PMID: 25792636
Canonical Wnt signaling was decreased after induction of experimental OA in S100A9-deficient mice. PMID: 26360647
In a model of liver injury induced hepatocellular carcinoma, mice lacking S100A9 express reduced neutrophil chemokines and are protected from HCC. PMID: 25879839
Data indicate that calgranulin B (S100A9) is essential for in vivo toll like receptor 3 (TLR3) signaling. PMID: 26385519
Myocardial gene and protein expression of S100A9 was also significantly increased in mice 1 day after debanding that had been preceded by 3 days or 1 week of transverse aortic constriction. PMID: 25820336
Identified TLR2 and S100A8/S100A9 as key regulators of hepatic CXCL-2 expression and neutrophil recruitment. PMID: 24333183
Data shows that S100A9 protein is not required for liver tumors to form although it is highly upregulated in liver cancers. PMID: 25331529
The mechanism of S100A9 is able to coincide with the inflammatory process. PMID: 24586443
S100A9, potentially with its partner S100A8, makes a major contribution in the host response to pneumococcal infection by increasing circulating neutrophils principally regulation of G-CSF production. PMID: 24776746
data identify a molecular pathway of thrombosis that involves platelet MRP-14 and CD36 and suggest that targeting MRP-14 has potential for treating atherothrombotic disorders, including MI and stroke. PMID: 24691441
The endogenous TLR-4 ligand Mrp8/14 has a pro-inflammatory role to a regulatory function in adaptive immunity. PMID: 23188082
Elevated S100A9 expression in colonic epithelial cells mediated by an IL-6/STAT3 signaling cascade may play an important role in the development of colitis. PMID: 22962574
S100A9 and TLR4 appear to be involved in promoting tumor growth in two different tumor models and pharmacological inhibition of S100A9-TLR4 interactions is a novel and promising target for anti-tumor therapies. PMID: 22470535
The absence of MRP-14 markedly increased T-cell activation and exacerbated allograft rejection, indicating a previously unrecognized role for MRP-14 in immune cell biology. PMID: 22144572
S100A9 expression in nonmyeloid cells is likely to contribute to atherosclerosis. PMID: 21382888
Neutrophil-derived protein S100A9 is a key player in the suppression of pro-inflammatory activation of macrophages. PMID: 19656587
results suggest that S100a9 induced by Abeta or CT contributes to cause inflammation, which then affects the neuropathology including amyloid plaques burden and impairs cognitive function PMID: 20098622
Upregulation and signaling of Mrp-8 and-14 contribute to neuroinflammation and the progression of ischemic damage. PMID: 19835955
MRP-14(-/-) mice showed no obvious phenotype and similar induced inflammatory response but myeloid cells were less dense. MRP-14 and MRP-8 are apparently dispensable for many myeloid cell functions PMID: 12640137
S100A9 plays a role in the inflammatory response to lipopolysaccharide by inducing the release of neutrophils from the bone marrow and directing their migration to the inflammatory site. PMID: 12928412
MRP14 deficient mice show a diminished recruitment of granulocytes into the granulation tissue during wound healing in vivo. PMID: 15331440
the C-terminus of S100A9 protein has a modulator effect on the function of adherent peritoneal cells PMID: 15953992
This study defines a lesion in S100A9 null neutrophils associated with inflammatory agonist-induced IP3-mediated Ca2+ release that is manifested at the level of PLCbeta. PMID: 16814379
These data demonstrate that the C-terminus of S100A9 protein interferes with control mechanisms of inflammatory pain. PMID: 16920226
Bronchoalveolar lavage fluid protein S100A9 is cleaved by matrix metalloproteinases 2 and 9 and is essential for regulating inflammatory pathways in experimental asthma. PMID: 17082650
Report showed S100A9 was expressed murine bone and cartilage cells and may contribute to calcification of the cartilage matrix and its replacement with trabecular bone, and to regulation of redox in bone resorption. PMID: 17636430
During the early phase of an experimental streptococcal lung infection model, antimicrobial protein S100A9 is expressed in pneumocytes and may play a critical role in regulating innate immunity and transepithelial migration of macrophages and neutrophils. PMID: 18292562
The delay in neutrophil recruitment in F. tularensis subsp. novicida-infected mice correlates with upregulation of cytokines, bacteremia, and release of high-mobility group box-1 and S100A9. PMID: 18411294
Data show that the degree of intrapancreatic trypsinogen activation is influenced by the extent of leukocyte infiltration into the pancreas which, in turn, depends on the presence of S100A9 that is secreted from polymorph nuclear leukocytes. PMID: 18452188
RAGE, carboxylated glycans and S100A8/A9 play essential roles in tumor-stromal interactions, leading to inflammation- PMID: 18689872
Regardless of their in vivo location, myeloid-derived suppressor cells synthesize and secrete the inflammatory mediator S100A9 that accumulates in the serum of tumor-bearing mice. PMID: 18802069
This study demonstrates that tumor-induced up-regulation of S100A9 protein is critically important for accumulation of myeloid-derived suppressor cells and reveals a novel molecular mechanism of immunological abnormalities in cancer. PMID: 18809714
S100A9 is upregulated after arylhydrocarbon receptor activation and involved in thymocyte emigration. PMID: 16114106

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.