Recombinant Mouse Protein-Lysine 6-Oxidase (LOX) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-04894P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Protein-Lysine 6-Oxidase (LOX) Protein (His-Myc)
Beta LifeScience
SKU/CAT #: BLC-04894P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Protein-Lysine 6-Oxidase (LOX) Protein (His-Myc) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P28301 |
| Target Symbol | LOX |
| Synonyms | Lox; Rrg; Protein-lysine 6-oxidase; EC 1.4.3.13; Lysyl oxidase; Ras excision protein) [Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form] |
| Species | Mus musculus (Mouse) |
| Expression System | Baculovirus |
| Tag | C-6His-Myc |
| Target Protein Sequence | DDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
| Expression Range | 163-411aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 32.4 |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture. |
| Subcellular Location | Secreted. Secreted, extracellular space. |
| Protein Families | Lysyl oxidase family |
| Database References | KEGG: mmu:16948 STRING: 10090.ENSMUSP00000025409 UniGene: PMID: 28624291 |
