Recombinant Mouse Protein Jagged-1 (JAG1) Protein (His-SUMO&Myc)

Beta LifeScience SKU/CAT #: BLC-02430P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Jag1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Jag1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Jag1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Jag1.

Recombinant Mouse Protein Jagged-1 (JAG1) Protein (His-SUMO&Myc)

Beta LifeScience SKU/CAT #: BLC-02430P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description Recombinant Mouse Protein Jagged-1 (JAG1) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q9QXX0
Target Symbol JAG1
Synonyms Jag1; Protein jagged-1; Jagged1; CD antigen CD339
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-10His-SUMO&C-Myc
Target Protein Sequence GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE
Expression Range 33-334aa
Protein Length Partial
Mol. Weight 53.6kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. May regulate fibroblast growth factor-induced angiogenesis.
Subcellular Location Membrane; Single-pass type I membrane protein.
Database References
Tissue Specificity Widely expressed in many tissues, with highest expression in brain, heart, muscle and thymus.

Gene Functions References

  1. Our findings reveal deep conservation of Jagged1-Notch2 signaling in patterning the pharyngeal arches from fish to mouse to man, despite the very different functions of their skeletal derivatives in jaw support and sound transduction. PMID: 28566723
  2. MFNG imposes a negative correlation between Jag1 and Notch, being high Jag1 in the absence of MFNG predictive of poor prognosis. PMID: 30065304
  3. these findings demonstrate the utility of soluble OX40 L and JAG1 to induce TCR-independent regulatory T-cells proliferation PMID: 28045060
  4. Missense mutant of Jag1 (Jag1(Ndr)) disrupts bile duct development and is responsible for Alagille syndrome phenotypes in heart, eye, and craniofacial dysmorphology. PMID: 29162437
  5. These findings demonstrate a critical role of osteolineage Jagged1 in bone homeostasis, where Jagged1 maintains the transition of osteoprogenitor to maturing osteoblasts. PMID: 28277610
  6. Data (including data from studies in transgenic mice) suggest that signaling via Notch2 and Notch3 plays role in promoting cell differentiation and steroidogenesis in preovulatory granulosa cells; mechanism involves regulation of gene expression of Jag1 and Rbpj. (Notch2 = Notch2 receptor; Notch3 = Notch3 receptor; Jag1 = jagged-1 protein; Rbpj = recombining binding protein suppressor of hairless) PMID: 29126263
  7. Notch1 signaling is activated in brain endothelial cells cocultured with astrocytes, and astrocytic Jagged1 expression is required for angiogenic enhancement. PMID: 26507745
  8. loss of Jag1 function in osteoblast lineage cells may contribute to the skeletal phenotype associated with Alagille syndrome. PMID: 27416809
  9. Epidermal stem cells accelerate diabetic wound healing via the Notch1 signaling pathway; Jag1 overexpression improves diabetic wound healing in vivo. PMID: 27129289
  10. pre-coated Notch1 protein promotes Notch1-knocked down B cells to produce antibody in LPS-stimulated B cells suggesting that Notch1 in other cells may promote antibody production by binding its ligands Dll1 and Jag1 in B cells. PMID: 28863329
  11. JAG1 is the main activator of NOTCH signaling and GDNF expression in Sertoli cells. PMID: 28051360
  12. the effects of two Notch ligands, i.e., Jagged1 and DLL1, on murine and human hematopoiesis in vitro. Our observations indicate that the stromal expression of Notch ligands increases the production of both the total and phenotypically early murine and human hematopoietic cells in the co-culture. PMID: 28537242
  13. Fringe modifications at EGF8 and EGF12 enhanced Notch1 binding to and activation from Delta-like 1, while modifications at EGF6 and EGF36 (added by Manic and Lunatic but not Radical) inhibited Notch1 activation from Jagged1. PMID: 28089369
  14. A Jagged1-Hey1 signal might mediate the impairment of angiogenesis induced by Ang II during cardiac hypertrophy. PMID: 28139517
  15. Data show that Rac1 induced nuclear import of STAT3 by physical binding, and nuclear STAT3 directly activated the transcription of essential oocyte-specific genes, including Jagged1, GDF9 and BMP15. PMID: 27050391
  16. Diabetes mellitus induces Jagged1 overexpression and suppresses Notch signaling in endothelial cells. Blocking Jagged1 prevented diabetes-induced microvasculopathy and could reverse it even after 4 weeks. PMID: 27407072
  17. Jagged1 intracellular domain-mediated inhibition of Notch1 signalling regulates cardiac homeostasis in the postnatal heart. PMID: 26249804
  18. endothelial Jagged1 has a role in promoting solid tumor development PMID: 26213336
  19. Jag1 expression in pulmonary capillary endothelial cells is upregulated after repeated lung injury and contributes to lung fibrosis. PMID: 26779814
  20. On a C57BL/6 background, Jag1 haploinsufficiency results in bile duct paucity in mice PMID: 26235536
  21. Jag1-induced Notch activity and the subsequent (or concomitant) downregulation of the Dll4-mediated signalling are both required for generating haematopoietic stem cells in the embryo. PMID: 26465397
  22. miR-34c overexpression inhibits the Notch signaling pathway by targeting Notch1 and Jaggged1 in high glucose-treated podocytes. PMID: 26191142
  23. miR-199b targeted the Notch ligand JAG1, resulting in vascular endothelial growth factor (VEGF) transcriptional activation and secretion through the transcription factor STAT3. PMID: 25535084
  24. study reports mesenchymal stromal cell-mediated immune modulation involves education and expansion of regulatory immune cells in a Jagged-1 dependent manner and reports the importance of Jagged-1 signalling in MSC protection against inflammation in vivo. PMID: 25890330
  25. Dll1 and Jag1, Notch ligands, function redundantly and are necessary to maintain the centroacinar cells as an environmental niche in the developing pancreas. PMID: 25919081
  26. Jagged1 is a novel binding partner of Fe65, and Fe65 may act as a novel effector of Jagged1 signaling. PMID: 26276215
  27. Vehicular exhaust particles activate an AhR-Jag1-Notch1 cascade to promote allergic airway inflammation in concert with proasthmatic alleles. PMID: 25825216
  28. Dysregulated expression and processing of Jagged1 protein, sustained by Notch3, takes part in a multistep oncogenic process, playing a role in controlling cell growth, apoptosis, and migration PMID: 25499214
  29. silencing prevents Notch2-driven osteoclast development and bone destruction in multiple myeloma PMID: 25257302
  30. Jag1 knockout maxillas revealed altered collagen deposition, delayed ossification, and reduced expression of early and late determinants of osteoblast development during maxillary ossification. PMID: 24491691
  31. Sox9 repression by Jag1 is continuously required to suppress the default chondrogenic fate of vascular smooth muscle cells PMID: 25535917
  32. The availability of Jag1 and Jag2 is key to generating a population of parabasal cells that later activate Notch1 and Notch2 for secretory-multiciliated cell fate selection. PMID: 25564622
  33. Although Jag1 shares a high degree of homology with Jag2 in the ectodomain region, BACE1 fails to cleave Jag2 effectively, indicating a selective cleavage of Jag1. PMID: 24907271
  34. cell-cell interactions with endothelial cells enforce quiescence and promote stem cell identity. Mechanistically, endothelial ephrinB2 and Jagged1 mediate these effects PMID: 25283993
  35. we identified by Western blot analysis a soluble form of JAGGED1 (JAG1) in primary mouse Sertoli cells that significantly influences the induction of regulatory T cells PMID: 24478388
  36. Extensive co-localization and relationship of Jag1 and Ddr1 in bile ducts and blood vessels in postnatal liver. PMID: 24391948
  37. Notch/Jagged1 activity is required for neural stem cell maintenance during granule cell neurogenesis PMID: 24530424
  38. Regulation of p53 by jagged1 contributes to angiotensin II-induced impairment of myocardial angiogenesis. PMID: 24098521
  39. The transcription and expression patterns of Notch pathway components (Notch 1-3, Delta1 and 4, Jagged1) and effectors (Hes1, Hes2, Hes5 and Nrarp) were evaluated in the mouse testis PMID: 24015274
  40. Analysis of mutant mouse lines for Col1a1 and Jag1 (Delta-Notch pathway) that both showed clear alterations in several bone-related parameters PMID: 23371561
  41. Reducing Jagged 1 and 2 levels prevents cerebral arteriovenous malformations in matrix Gla protein deficiency. PMID: 24191040
  42. we found that mice with reduced Jag1 expression (mice heterozygous for a null mutation in Jag1, Jag1(+/-)) showed a selective impairment in spatial memory formation. PMID: 23567106
  43. Jagged1-mediated Notch signaling regulates multiple cell fate decisions as well as differentiation in the respiratory system to coordinate lung development and to maintain a balance of airway cell types in adult life PMID: 23526493
  44. These results showed a critical role for OX40L- and Jagged1-induced cosignaling in GM-BMDC-induced Treg expansion. PMID: 23630352
  45. The results indicate that Jagged-1-Hes-1 signaling can suppress the skewing of CD4+ T cells toward Th17 cells via RORgammat, for which Hes-1 may be crucial. PMID: 23489689
  46. The Jagged1/Notch1 and Notch2/Delta-like 1 axes differentially regulate osteoclastogenesis. PMID: 22390640
  47. Jagged1 protein mouse mediated Notch signaling regulates the inner ear development in mammalians. PMID: 22998557
  48. Notch signaling through the Jagged1 from astrocytes to neural stem/progenitor cells depends on the intermediate filament proteins GFAP and vimentin. PMID: 22887872
  49. This work demonstrates a crucial role for Jag1 in heart valve morphogenesis. PMID: 23095891
  50. Jagged1 is a potent downstream mediator of the bone metastasis cytokine TGFbeta that is released during bone destruction. Importantly, gamma-secretase inhibitor treatment reduces Jagged1-mediated bone metastasis by disrupting Notch pathway in stromal bone cells PMID: 21295524

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed