Recombinant Mouse Protein Flightless-1 Homolog (FLII) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-08601P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Protein Flightless-1 Homolog (FLII) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-08601P
Collections: Fc receptors, Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Protein Flightless-1 Homolog (FLII) Protein (His-B2M) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9JJ28 |
Target Symbol | FLII |
Synonyms | Flii; Fli1; FliihProtein flightless-1 homolog |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-6His-B2M |
Target Protein Sequence | VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGSSLDPRFVFLLDQGLDIYVWRGAQATLSNTTKARLFAEKINKNERKGKAEITLLVQGQEPPGFWDVLGGEPSEIKNHVPDDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPGMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHTVVSRSLEGTE |
Expression Range | 495-827aa |
Protein Length | Partial |
Mol. Weight | 52.0kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Essential for early embryonic development. May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration, by inhibiting Rac1-dependent paxillin phosphorylation. |
Subcellular Location | Nucleus. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell junction, focal adhesion. Note=Colocalizes to actin-rich structures in blastocysts and, together with HRAS, RHOA and CDC42, in migrating fibroblasts. Localizes to centrosomes. |
Database References | |
Tissue Specificity | Expressed in blastocyst. |
Gene Functions References
- Fluorescence resonance energy transfer experiments showed that FliI-NMMIIA interactions require Ca(2+) influx. We conclude that Ca(2+) influx through the TRPV4 channel regulates FliI-NMMIIA interaction, which in turn enables generation of the cell extensions essential for collagen remodeling PMID: 28526784
- Flii genetic expression is enhances tissue regeneration, after claw amputation. PMID: 27595936
- Studies suggest that Flii enhances cutaneous squamous cell carcinoma progression by decreasing apoptosis and enhancing tumor cell invasion. PMID: 26497552
- P-Rex1 stimulates migration through enhancing the interaction between Rac1 and the actin-remodelling protein. PMID: 26887924
- Genes downstream from Flii, including TGF-beta1 and TGF-beta3, showed significantly altered expression confirming a functional effect of the Rhodamine-Flii small interfering RNA on gene expression PMID: 25838352
- FliI interacts with NMMIIA to promote cell extension formation, which enables collagen remodeling in fibroblasts. PMID: 25877872
- FLII functions in PPARgamma activation as a molecular switch to repress transcriptional activity by interrupting formation of the PPARgamma/RXRalpha complex. PMID: 25479590
- LRRFIP2 inhibits NLRP3 inflammasome activation by recruiting the caspase-1 inhibitor Flightless-I, thus outlining a new mechanism for negative regulation of NLRP3 inflammasome. PMID: 23942110
- increasing the level of Flii in diabetic mouse wounds led to increased TLR4 and NF- kappa B production. Treatment of murine diabetic wounds with neutralising antibodies to Flii led to an improvement in healing with decreased expression of TLR4 PMID: 23555084
- Using a mouse model of epidermolysis bullosa acquisita, the effect of "mopping up" Flii using Flii-neutralizing antibodies before, during, and after blister formation was determined. PMID: 23223144
- Flii is constitutively secreted from macrophages and fibroblasts and is present in human plasma. PMID: 22718342
- FliI regulates cell migration through its localization to focal adhesions and its ability to cap actin filaments, which collectively affect focal adhesion maturation. PMID: 22581781
- Data show that mice with elevated Flii expression exhibit impaired wound healing. PMID: 21786402
- Overexpression of Flii produced severe blistering post-induction of EBA, while decreased Flii reduced blister severity, elevated integrin expression, and improved ColVII production. PMID: 21984127
- show that Flii modulation of focal adhesions and filamentous actin stress fibers is Rac1-dependent PMID: 21430700
- Flii appears to have a positive role in the regeneration of hair follicles, contrary to its negative influence on wound healing in skin PMID: 21191408
- performs an essential function in early embryonic development PMID: 11971982
- Directly interferes with the formation of the TLR4-MyD88 signaling complex. PMID: 16424162
- FliI is a contributing factor to impaired healing and strategies aimed at decreasing FliI levels in elderly skin may improve wound repair. PMID: 18191609
- Flii may regulate wound repair through its effect on hemidesmosome formation and integrin-mediated cellular adhesion and migration. PMID: 19212345
- These findings support the model that CISK phosphorylates FLII and activates nuclear receptor transcription and suggest a new cell survival signaling pathway mediated by PI 3-kinase and CISK. PMID: 19293151