Recombinant Mouse Protein Fam3B (FAM3B) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07450P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Protein Fam3B (FAM3B) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07450P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Protein Fam3B (FAM3B) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9D309 |
Target Symbol | FAM3B |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR |
Expression Range | 30-235aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 30.4 kDa |
Research Area | Cytokine |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. |
Subcellular Location | Secreted. |
Protein Families | FAM3 family |
Database References | |
Tissue Specificity | Expressed at high levels in the pancreas and, to a lesser extent, in small intestine and prostate. Also detected in stomach, testis and fetal liver. In the pancreas, localized in the islets of Langerhans; in the testis, found primarily in the round sperma |
Gene Functions References
- these findings indicate that intestinal L cells are responsive to PANDER, and elevated PANDER levels impair GLP-1 production in vitro and in vivo. PMID: 28549991
- in-vitro and in-vivo glucose is a potent stimulator of the PANDER promoter within the liver and this response may be facilitated by ChREBP. PMID: 26123584
- F3MB(PANDER) decreases mice hepatic triglyceride and is associated with decreased DGAT1 expression PMID: 25679806
- X-ray crystal structure of the mouse FAM3B protein. PMID: 23333428
- these results demonstrated that the JNK-mediated signaling mechanism of palmitic acid -induced beta-cell apoptosis involves up-regulated expression of PANDER and activation of caspase-3. PMID: 22542939
- Data suggest a new link between the endocrine and immune systems and provide useful information for further investigating the physiological functions of PANDER and its involvement in inflammation-related pancreatic disorders. PMID: 21664946
- Palmitic acid induces the expression of PANDER and the apoptosis of beta-TC3 cells while glucagon-like peptide-1 counteracts the above effects through an activation of Akt signaling. PMID: 21756815
- PANDER promotes lipogenesis and compromises insulin signaling in the liver by increasing FOXO1 activity. PMID: 21412813
- Findings further indicate PANDER impacts glycemic levels and may represent a potential but complicated therapeutic target. PMID: 21486565
- A paracrine/endocrine effect of insulin on Pander release and a potential glucose-regulatory role for Pander. PMID: 20638985
- we provide evidence that identifies PANDER as a regulator of hepatic glucose metabolism, where it amplifies hepatic cAMP and cAMP-response element-binding protein signaling to induce gluconeogenic gene expression and glucose output. PMID: 20844005
- Potential role of PANDER in the pancreatic beta-cell for regulation or facilitation of insulin secretion, shown in PANDER knockout mice. PMID: 20566664
- In conclusion, Ad-PANDER infection is as effective as truncated recombinant PANDER to induce betaTC3 cell and mouse islet apoptosis. PMID: 15928025
- Because FAM3B (PANDER) mRNA expression is up-regulated by IFNgamma, a cytokine implicated in the pathogenesis of type 1 diabetes, PANDER may contribute to the pathogenesis of beta-cell death. (FAM3B) PMID: 16006032
- Tissue-specific and glucose-responsive expression of FAM3B promoter were studied. PMID: 16102856
- Because PANDER (FAM3B) is expressed by pancreatic beta-cells and in response to glucose in a similar way to those of insulin, PANDER may be involved in glucose homeostasis PMID: 17962352
- PANDER is a potential PDX-1 target gene and the A box sites within the promoter region are critical for basal and glucose-stimulated PANDER expression. PMID: 18708173
- liver is a target for PANDER, and PANDER may be involved in the progression of diabetes by regulating hepatic insulin signaling pathways. PMID: 19683528