Recombinant Mouse Protein C-Fos (FOS) Protein (His)

Name: Recombinant Mouse Protein C-Fos (FOS) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07318P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Protein C-Fos (FOS) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P01101
Target Symbol	FOS
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFTLPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYAADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Expression Range	1-380aa
Protein Length	Full Length
Mol. Weight	46.8 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex, at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.
Subcellular Location	Nucleus. Endoplasmic reticulum. Cytoplasm, cytosol.
Protein Families	BZIP family, Fos subfamily
Database References	KEGG: mmu:14281 STRING: 10090.ENSMUSP00000021674 UniGene: PMID: 29463002 Both cyclic AMP responsive element binding protein (CREB)-dependent transcription and CPEB4-promoted translation support c-FOS expression early postnatal olfactory bulbs but disengage in adult olfactory bulbs PMID: 29166615 We demonstrate that overexpression of Gfi1b, c-Fos, and Gata2, previously reported to transdifferentiate fibroblasts into hematopoietic progenitors in vitro, can induce long-term HSC formation in vivo. PMID: 28943250 these data demonstrated that wedelolactone facilitated osteoblastogenesis through Wnt/GSK3beta/beta-catenin signaling pathway and suppressed RANKL-induced osteoclastogenesis through NF-kappaB/c-fos/NFATc1 pathway. PMID: 27558652 The data of this study suggest that Fos expression during simple associative learning labels ensembles activated generally by arousal rather than specifically by a particular sensory cue. PMID: 28331016 The specific expression of this long MEX3C isoform in oocytes and its ability to enhance FOS mRNA nuclear export and stability all suggest that MEX3C(659AA) is an RNA-binding protein that preserves maternal FOS mRNA in oocytes. PMID: 27053362 we performed cotransfections of AP-1 expression plasmids with different mouse Gja1 promoter/luciferase reporter constructs within TM3 Leydig and TM4 Sertoli cells.We showed that a functional cooperation between cJun and cFos activates Gja1 expression and requires an AP-1 DNA regulatory element located between -132 and -26 bp PMID: 28903063 hypergravity down-regulated c-fos expression transiently via ROCK/Rho-GTP and PI3K signaling. PMID: 28953959 These findings suggested that the photoreceptor c-Fos controls blood vessel growth into the normally avascular photoreceptor layer through the inflammatory signal-induced STAT3/VEGFA pathway. PMID: 28465464 c-FOS and DUSP1 expression levels determine the threshold of tyrosine kinase inhibitor (TKI) efficacy, such that growth-factor-induced expression of c-FOS and DUSP1 confers intrinsic resistance to TKI therapy in a wide-ranging set of leukemias. PMID: 28319094 the protein and RNA levels of RANKLinduced cFos and nuclear factor of activated T-cell cytoplasmic 1 were suppressed by centipedegrass extract (CGE). These results indicated that CGE may serve as a useful drug in the prevention of bone loss. PMID: 27035226 Fos and phosphorylation of extracellular signal-regulated kinases (ERK) were used to look for evidence that interneurons expressing GRP were activated following intradermal injection of chloroquine. PMID: 27270268 this study shows that the inhibitory effect of tatrinan O on osteoclast formation is via decreasing the expression of NFATc1 and c-Fos PMID: 26971224 The study quantified monosodium glutamate (MSG)--evoked brain activity, as measured by c-Fos, in the nucleus of the solitary tract (nTS). The number and pattern of c-Fos neurons in the nTS of animals that were water-restricted and received a constant infusion of MSG via intraoral cannula most closely mimicked animals that consumed MSG from a bottle. PMID: 26762887 these results suggested that piperine inhibited osteoclast differentiation by suppressing the p38/NFATc1/c-Fos signaling axis PMID: 26627060 Tumorigenesis by Meis1 overexpression is accompanied by a change of DNA sequence specificity which allows binding to the AP-1 element. PMID: 26259236 this is the first report implicating M-CSF/DGKzeta/DAG axis as a critical regulator of bone homeostasis via its actions on OC differentiation and c-Fos expression. PMID: 25891971 An intriguing finding was that S1P induced c-Fos-inhibited CCL5 directly and also indirectly through inhibition of the IFN-beta amplification loop PMID: 26246404 These results suggest that c-Fos is involved in the normal development of Neural Stem Progenitor Cells PMID: 26143639 Mechanistically, mTOR plays a crucial role in c-fos expression, thereby modulating NFkappaB binding to promoters of IL-12 and IL-10. PMID: 26122641 cFOS plays a cell-specific role at multiple levels of the hypothalamic-pituitary-gonadal axis, affecting gonadotropes but not thyrotropes in the pituitary, and kisspeptin neurons but not GnRH neurons in the hypothalamus. PMID: 25958044 These results suggest that TGF-beta regulates RANKL-induced osteoclastogenesis through reciprocal cooperation between Smad2/3 and c-Fos. PMID: 25431176 measured gene expression of Fos, Per1 and Sgk1 45 min after exposure to brief cold swim stress in male and female mice; stress induced a stronger increase in Fos and Per1 expression in females than males PMID: 25459888 Transcriptional activity of early genes involved in memory process, such as FBJ osteosarcoma oncogene (Fos) is increased in the hippocampus of hypercholesterolemic LDL receptor knockout mice. PMID: 25797218 Spontaneous seizures in Kcna1-null mice activate Fos expression in select limbic circuits PMID: 26112121 c-Fos expression in the dorsal hippocampus of Gria1-/- mice PMID: 25446922 This study finding of a correlation between SERT and c-FOS protein expression affected by PS, together with related mRNAs. PMID: 25102410 Results show a difference in Fos expression in the hippocampus between B6 and D2 mice after 1 flurothyl-induced seizure PMID: 25524858 Data show that retinoic acid receptor gamma (RARgamma)-proto-oncogene protein c-fos (c-Fos)-PPARgamma2 (PPARgamma2) signaling rather than reactive oxygen species generation is critical for all-trans retinoic acid (ATRA)-inhibited adipocyte differentiation. PMID: 25173565 Data suggest that p38 MAP kinase regulates c-fos/cellular oncogene fos mRNA stability/decay by affecting state of phosphorylation of Elavl1/HuR (Hu antigen R). PMID: 25588078 c-Fos expression in the medial preoptic area (mPOA) was significantly higher in sires that exhibited retrieval behavior (retrievers) than those with no such behavior (non-retrievers). PMID: 25208928 Pik3cd inactivation leads to extracellular matrix degradation in vessels and promotes aneurysm development by inducing macrophage migration and upregulating the activator protein-1/MMP-12 pathway in macrophages. PMID: 25503990 The results of this study conclude that fosGFP expression discriminates between single- and multi-whisker receptive field layer 2 pyramidal neurons. PMID: 25453844 Data suggest that c-Fos (not c-Jun) regulates phospholipid synthesis in cell nucleus; c-Fos localizes to nucleus and modulates genetic transcription through activation of Pip5k1 (phosphatidylinositol-4-monophosphate 5-kinase). PMID: 24819416 the distinct requirement of NF-kappaB for mouse and human c-fos regulation PMID: 24386331 The expression of the c-fos gene increased the most among phencyclidine-dependent differentially expressed genes between WT and GluN2D knockout out mice. PMID: 24330819 Heterogeneous nuclear ribonucleoprotein R cooperates with mediator to facilitate transcription reinitiation on the c-Fos gene. PMID: 23967313 analysis of the temporal pattern in cfos activation in cortical and brainstem areas implicated in the control of appetite and body weight regulation PMID: 24424063 Using transgenic mice overexpressing the AP-1 inhibitor JDP2, a central role of AP-1 in the induction of hypertrophy and apoptosis in cardiomyocytes is demonstrated. PMID: 23612584 Orientation within a high magnetic field determines swimming direction and c-Fos induction in brain stem vestibular nuclei. PMID: 23720133 c-Fos transcriptionally controls mmp10 and s100a7a15 expression in keratinocytes, subsequently leading to CD4 T-cell recruitment to the skin, thereby promoting epidermal hyperplasia that is likely induced by CD4 T-cell-derived IL-22 PMID: 24029918 the restructuring of muscarinic receptor mRNA correlations reveals an additional mechanism for adaptation to the c-fos gene knockout PMID: 23395867 The inhibitory effect of inflammation and tensile strain on osteogenicity is associated with the upregulation in c-fos expression. PMID: 23727355 this study examined c-Fos expression induced by repeated maternal separation andsingle time maternal separation in pre-weaned mice, with the aim of determining whether newborn animals become desensitised to repeated maternal absence. I PMID: 22913644 the role of GnRH in the regulation of gonadotropin gene expression is seen by highlighting the role of c-Fos posttranslational modification that may cause higher levels of FSH during the time of low GnRH pulse frequency to stimulate follicular growth. PMID: 23275456 c-Fos and polo-like kinase 2 induction is impaired in the limbic system of fear-conditioned alpha-synuclein transgenic mice PMID: 23209687 Data indicate that FOS, SPI1, KLF10, TFEC, and PRDM16 show robust transcriptional cross-regulation and are often associated with osteoclastogenesis. PMID: 23340137 ApoE plays an inhibitory role in osteoclast differentiation via the suppression of RANKL-dependent activation of NF-kappaB and induction of c-Fos and NFATc1. PMID: 23246654 Data suggest that miR-181a attenuates ox-LDL-stimulated immune inflammation responses by targeting c-Fos in dendritic cells. PMID: 22956783 hypothalamic c-Fos activation is regulated by daily scheduled high fat meals in mice PMID: 22815954

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.