Recombinant Mouse Protein Atonal Homolog 1 (ATOH1) Protein (His)

Name: Recombinant Mouse Protein Atonal Homolog 1 (ATOH1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-09234P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Protein Atonal Homolog 1 (ATOH1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P48985
Target Symbol	ATOH1
Synonyms	Atoh1; Ath1Protein atonal homolog 1; Helix-loop-helix protein mATH-1; mATH1
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEAS
Expression Range	1-351aa
Protein Length	Full Length
Mol. Weight	41.9 kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Subcellular Location	Nucleus.
Database References	KEGG: mmu:11921 STRING: 10090.ENSMUSP00000098903 UniGene: Mm.57229
Tissue Specificity	Developing nervous system, and in adult epithelial cells of the gastrointestinal tract.

Gene Functions References

Sox4 promoted tuft and enteroendocrine cell lineage allocation independently of Atoh1. These results challenge the longstanding model in which Atoh1 is the sole regulator of secretory differentiation in the intestine and are relevant for understanding epithelial responses to parasitic infection. PMID: 30055169
The results of this study presented here from various Atoh1 mutants demonstrate that neither peripheral nor central target cell differentiation is necessary for cochlear afferent segregation from vestibular afferents or for some degree of a cochleotopic segregation PMID: 28450830
Atoh1 function in hair cell differentiation is modulated by interaction with other transcription factors, such as Gfi1 and Pou4f3. (Review) PMID: 27751776
The data suggest that ErbB3 restricts Paneth cells numbers through PI3K-mediated suppression of Atoh1 levels leading to inhibition of Paneth cells differentiation, with important implications for regulation of the intestinal stem cells niche. PMID: 28304405
This study illustrates a SHH-Stox1-Math1 regulatory axis in normal cerebellar development and medulloblastoma formation. PMID: 27564589
This work reveals a dynamic ATOH1-driven molecular cascade underlying medulloblastoma metastasis that offers possible therapeutic opportunities PMID: 28490517
The discovery that Atonal homolog 1 (Atoh1) governs the development of the sensory hair cells in the inner ear led to therapeutic efforts to restore these cells in cases of human deafness. PMID: 28729444
miR-183 family expression in combination with Atoh1 not only appears to fine tune gene expression in favor of hair cells fate, but is also required for the expression of some hair cell-specific genes. PMID: 28686713
These data illuminate a genetic pathway that initiates auditory HC regeneration and suggest p27(Kip1), GATA3, and POU4F3 as additional therapeutic targets for ATOH1-mediated auditory hair cells regeneration. PMID: 28402854
Study provides evidence that Sox2 expression is required for the late stages of progenitor cell differentiation to hair cells and stimulates Atoh1 expression through a concentration dependent molecular interaction with the 3' enhancer of Atoh1. PMID: 26988140
Hes/Hey signaling at the Atoh1 promoter has a role in selection of cell fate in the organ of Corti PMID: 26932672
The retrotrapezoid nucleus neurons expressing Atoh1 and Phox2b are essential for the respiratory response to CO2. PMID: 25866925
propose Atoh1 neurons tune the sequential activation of independent oscillators essential for the fine control of different muscles during breathing PMID: 24842997
our data indicate that beta-catenin and Atoh1 mediate synergistic effects on both proliferation and differentiation of a subset of neonatal cochlear Lgr5+ cells PMID: 26224861
Atoh1 expression is sufficient to produce new Merkel cells in the epidermis PMID: 26138479
The transcription factor Atoh1 is required for initial Merkel cell specification. PMID: 25468937
The existence of spatial compartmentation in the rhombic lip and the interplay between Wls, Math1, and Pax6 in the rhombic lip provides novel views of early cerebellar development. PMID: 25209290
Normal lifespan and fecundity of Atoh1(trhl) mice provide a complementary model to facilitate elucidation of ATOH1 function in hearing,central nervous system and cancer biology. PMID: 24265785
Msx1 and Msx2 proteins activate Atoh1 transcription by specifically interacting with several homeodomain binding sites in the Atoh1 3' enhancer. PMID: 24715462
The results of this study suggested that Atoh1 specify spatial identities of cerebellar neuron progenitors in the neuroepithelium, leading to appropriate production of GABAergic and glutamatergic neurons, respectively. PMID: 24695699
Math1 plays a critical role in the pathogenesis of otitis media by induction of mucous cell differentiation in the presence of TNF-alpha and retinoic acid. PMID: 23783432
the cerebellar Atoh1 precursor pool is partitioned into spatial domains that reflect the activity of two organisers: an isthmic Atoh1 domain, which gives rise to isthmic nuclei, and the rhombic lip, which generates cerebellar nuclei and granule cells PMID: 24381197
Math1 may be an important factor for induction of hair cell-like cells from differentiating embryonic stem cells. PMID: 23828563
Continued Atoh1 expression is necessary for differentiation of vestibular hair cells. PMID: 23796904
Conditional induction of Math1 specifies embryonic stem cells to cerebellar granule neuron lineage and promotes differentiation into mature granule neurons. PMID: 23225629
The results of this study suggested that Atoh1 regulates multiple aspects of hair cell development and function. PMID: 23761906
The Atoh1-expressing lineage is established early in cochlear development and gives rise to hair cells and supporting cells. PMID: 23318633
Expression of Atoh1 in retrotrapezoid neurons is not required for their specification or maintenance, but is important for their proper localization and to establish essential connections with the preBotzinger complex. PMID: 22958821
Atoh1 is broadly upregulated in supporting cells after damage, but a substantial proportion of supporting cells with Atoh1 activation fail to acquire hair cell features, in part due to gamma secretase-dependent activities. PMID: 22543087
involved in differentiation of neurons, secretory cells in the gut, and mechanoreceptors including auditory hair cells [review] PMID: 22370966
Math1-deficient crypts counteract the absence of Paneth cell-derived Wnts and prevent base columnar cell-stem cell exhaustion. PMID: 22586121
Data show that Atoh1 is crucial for hair cell mechanotransduction development, viability, and maintenance. PMID: 22279587
Atoh1(KINeurog1) can provide some degree of functional support for survival of organ of Corti cells. PMID: 22292060
Atoh1, Hes1, and Gfi1b form a fate-determining Notch signaling driven ternary switch in the developing intestinal epithelium. PMID: 22185794
This study demonistrated that Atoh1 in the developing spinal cord that represent genes enriched in the Atoh1-expressing cells in the dorsal neural tube. PMID: 21795538
Atoh1 (Pax2-Cre) CKO mice undergo a rapid change of the embryonic prosensory epithelium through exaggerated cell death that results in near complete cellular loss of the organ of Corti PMID: 21146598
Genes expressed in Atoh1 neuronal lineages arising from the r1/isthmus rhombic lip.( PMID: 21440680
acetylcholine receptor alpha could be the first transcriptional target of ATOH1 in the inner ear PMID: 17961150
ATOH1 is essential for tuft cell differentiation. PMID: 21383077
Study demenstrate that the conversion of intestinal stem cells into goblet cells upon inhibition of the Notch signalling pathway requires Math1. PMID: 20975679
besides transmitting Notch signals, the transcription factor Hes1 acts downstream of Math1 to regulate expression of cell cycle inhibitors and intestinal crypt cell replication. PMID: 21282114
created a comprehensive list of over 600 direct Atoh1 target genes in the postnatal cerebellum. Atoh1 binds to a 10 nucleotide motif to directly regulate genes involved in migration, cell adhesion, metabolism, and other previously unsuspected functions. PMID: 21300888
Thus, Math1 is a key effector directing multipotential precursors to adopt secretory and not absorptive cell fate. PMID: 20691176
Atoh1 up-regulation may either be a result of Hes5 down-regulation or mediated by another signaling pathway during hair cell regeneration in the mouse utricle. PMID: 20433915
Atoh1 expression is associated with the sensory organs in the inner ear. PMID: 20533400
Atonal homolog 1 is required for growth and differentiation effects of notch/gamma-secretase inhibitors on normal and cancerous intestinal epithelial cells. PMID: 20621629
Taken together, our data suggest that SHH plays an important role in the promotion of auditory hair cell differentiation via the Math1-Brn3.1 signaling pathway. PMID: 19908278
Data show that Hnf1alpha and beta act upstream of the Notch pathway controlling directly the expression of two crucial components: Jag1 and Atoh1. PMID: 20388655
Math1 is required for the conscious proprioceptive system, including excitatory projection neurons of the dorsal column nuclei and for vital components of the interoceptive system, such as Barrington's nucleus, that is closely associated with arousal. PMID: 20080794
Beta-catenin expression was required for increased expression of Atoh1 after Notch inhibition. PMID: 19864427

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.