Recombinant Mouse Pro-Neuropeptide Y (NPY) Protein (hFc)

Name: Recombinant Mouse Pro-Neuropeptide Y (NPY) Protein (hFc)
Brand: Beta LifeScience
SKU: BLC-01172P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Pro-Neuropeptide Y (NPY) Protein (hFc) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P57774
Target Symbol	NPY
Species	Mus musculus (Mouse)
Expression System	Yeast
Tag	N-hFc
Target Protein Sequence	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Expression Range	29-64aa
Protein Length	Partial
Mol. Weight	30.9 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Subcellular Location	Secreted. Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle.
Protein Families	NPY family
Database References	KEGG: mmu:109648 STRING: 10090.ENSMUSP00000031843 UniGene: PMID: 30201296 nalysis of hypothalamic and neuroendocrine responses to HFS throughout the light-dark cycle suggests uncoupling of hypothalamic responses involving appetite-stimulating fasting-responsive hypothalamic neurons expressing agouti-related peptide (AgRP) and neuropeptide Y (Npy). PMID: 28294152 In this study we demonstrate dynamic changes in the number of calretinin- (CR) and neuropeptide Y-expressing (NPY) interneurons in the motor cortex of the familial hSOD1(G93A) ALS mouse model, suggesting their potential involvement in motor neuron circuitry defects. PMID: 28294153 Study demonstrated that Skn-1a is only expressed when neuropeptide Y (NPY) is activated in microvillar cells (MVCs). Therefore the expression of NPY is necessary for the transcription factor-mediated differentiation of olfactory MVCs. PMID: 29530408 Although acute loss of hypothalamic neurons that produce appetite-stimulating neuropeptide Y (Npy) and agouti-related peptide (Agrp) in adult mice or in mice homozygous for the anorexia (anx) mutation causes aphagia, our understanding of the factors that help maintain appetite regulatory circuitry is limited PMID: 28093506 NPY knockout mice displayed altered behaviour as well as molecular and morphological changes in amygdala and hippocampus. NPY knockout mice responded to stress with exaggerated hyperthermia, displayed impaired spatial memory, had higher hippocampal brain-derived neurotrophic factor mRNA levels and altered hippocampal synaptic plasticity, effects which were not seen in wildtype mice. PMID: 27305846 Orthopedic surgery modulates the expression of neuropeptide Y and BDNF at the spinal and hippocampal levels. PMID: 27791037 salience of the background context memory is modulated through muscarinic activation of NPY(+) hilar perforant path associated interneurons and NPY signaling in the dentate gyrus PMID: 28775269 NPY deficient mice had significantly impaired Hematopoietic stem/progenitor cell (HSPC) mobilization due to increased expression of HSPC maintenance factors by reduction of matrix metalloproteinase-9 (MMP-9) activity in bone marrow. PMID: 27090492 These results identify SK3 as a key intrinsic mediator that coordinates nutritional status with AgRP/NPY neural activities and animals' feeding behavior and energy metabolism. PMID: 27829152 The vasoconstrictive mechanism has been identified as neuropeptide Y acting on Y1 receptors. PMID: 27244241 Findings suggest that neuropeptide Y is expressed by distinct populations of neurons can modulate afferent and efferent projections of the central amygdala via presynaptic Y2 receptors located at inhibitory and excitatory synapses. PMID: 26365505 arcuate nucleus NPY neuropathway to the paraventricular nucleus and dorsomedial hypothalamus is pivotal in obesity-induced elevations in sympathetic nerve activity. PMID: 28628036 NPY promotes airway hyperresponsiveness through the induction of Rho kinase activity and phosphorylation of myosin light chain, which induces airway smooth muscle contraction. PMID: 27088802 stress alters CA1 circuit function through the impairment of endogenous NPY release, potentially contributing to heightened anxiety PMID: 28053027 Npy expression is decreased in the cingulate cortex following chronic unpredictable stress. PMID: 27737789 The results showed that NPY system activity is increased in a time- and space-dependent manner during bone repair. PMID: 27802308 Decreased neuropeptide Y (NPY) expression in the extended amygdala might be causally linked with the depression induced following type 2 diabetes and that the antidepressant action of imipramine in diabetic mice might be mediated by NPY-NPY Y1 receptor system. PMID: 27208493 lipolytic/thermogenic signaling, beta3-adrenergic receptor/hormone sensitive lipase, was markedly activated in white adipose tissue of NPY(-/-) mice compared with that of NPY(+/+) mice. PMID: 28101970 These data establish the existence of a microRNA-mediated cross talk between enteric neurons producing NPY and intestinal epithelial cells, and the potential of neuropeptide-regulated miRNAs as potential therapeutic molecules for the management of inflammation-associated tumors in the gut. PMID: 27856419 Stress may be associated with elevated peripheral neuropeptide Y level, which was observed to be associated with exacerbated airway inflammation in asthmatic mice. PMID: 26673939 that preconditioning of mice with intermittent mild hypobaric hypoxia induces anxiolytic- and antidepressant-like effects which are accompanied by up-regulation of NPY which may suggest its mechanistic role PMID: 26994415 confirms the critical role of Y2 signalling to control neuropeptide Y and associated pro-opiomelanocortin expression in the arcuate nuclei PMID: 26444586 Neuropeptide Y (NPY) has been shown to be important in the modulation of anxiety. PMID: 26882036 Diet composition, not calorie intake, rapidly alters intrinsic excitability of hypothalamic AgRP/NPY neurons in mice. PMID: 26592769 NPY might be involved in the pathogenesis of METH-induced atherogenic effects through NPY Y1 receptor pathway in ApoE knockout mice PMID: 26409626 NPY deficiency leads to reduced orexigenic stimulation and water diffusion parameters PMID: 25968479 NPY suppresses cAMP activation of brown-like adipocytes via down-regulation o brown fat-relevant gene expression and mitochondrial function. PMID: 25451330 Data show that chronic caloric restriction (CR) alters hypothalamic agouti-related protein (Agrp) and neuropeptide Y (Npy) gene expression similarly in Ghrelin+/+, Ghrelin-/-, ghrelin receptor Ghsr+/+, and Ghsr-/- mice. PMID: 26812158 These data demonstrate a clear role for neuropeptide Y as a negative regulator of monocyte recruitment into the central nervous system and provide a new mechanism for suppression of retrovirus-induced neurological disease. PMID: 26719257 NPY levels are decreased in Machado-Joseph disease (MJD) and that NPY overexpression is able to alleviate neuropathology and motor deficits in different MJD mouse models. PMID: 26220979 Prader-Willi critical region deletion in mice containing Snord116, and specifically in NPY neurons, recapitulates the short stature and low bone mass density and aspects of the hormonal imbalance of Prader-Willi syndrome individuals. PMID: 26824232 Npy gene expression in the arcuate nucleus is increased by intermittent fasting in diet-induced obese male mice. PMID: 26653760 NPY expression is increased during atherogenesis and in particular in unstable plaques PMID: 24858338 blocking the leptin-deficient increase in neuropeptide Y (NPY) expression reverses the cortical bone loss in ob/ob mice. PMID: 23044938 reduction was observed in the neuropeptide Y (NPY)-positive subpopulation of GABAergic neurons in senescence-accelerated mouse prone 8 PMID: 26250996 Results suggest that calorie restriction-induced changes in NPY are not directly involved in the suppression of lipopolysaccharide-induced microglial activation, however, NPY may indirectly affect microglial morphology through changes in body temperature PMID: 25446356 NPY reduces neuronal firing in the nucleus accumbens resulting in increased palatable food intake PMID: 25109664 Agrp-raptor KO mice displayed reduced, non-circadian expression of Agrp and NPY but normal feeding behavior and energy homeostasis on both normal and high fat diet PMID: 26159924 Neuropeptide Y regulates the hematopoietic stem cell microenvironment and prevents nerve injury in the bone marrow. PMID: 25916827 increase in pancreatic islet NPY level has little impact on islet function and is insufficient to affect glucose homeostasis PMID: 25285650 Neuropeptide Y stimulates autophagy in hypothalamic neurons PMID: 25775546 Following activation of PPARgamma, there was an increase in neuropeptide Y in the arcuate hypothalamus. PMID: 25788674 NPY protects against excessive stress-induced bone loss. PMID: 24535841 Results suggest that inhibition of NPY signaling in the brain by CCK-4 might be causal to anxiety- and depression-like behaviors PMID: 25106129 NPY and PYY are required for CRF1 modulation of feeding behavior during stress. PMID: 25238483 Study shows pronounced adaptive changes in the mouse hippocampus both with regard to NPY synthesis and NPY receptor synthesis and binding, which may contribute to regulating neuronal seizure susceptibility after kainate PMID: 24985894 NPY and its Y receptor are possible mediators of both vasoconstriction and pulmonary vascular remodelling in pulmonary hypertension PMID: 24779394 Deletion of NPY did not impact fed growth hormone release; however, it reversed the fasting-induced suppression of pulsatile GH secretion PMID: 25471570 NPY deficiency reduces adiposity and ameliorates the age-related imbalance of adipose tissue metabolism, suggesting that antagonism of NPY may be a promising target for drug development to prevent age-related metabolic diseases PMID: 25205743

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.