Recombinant Mouse Peptidoglycan Recognition Protein 1 (PGLYRP1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11188P

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pglyrp1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pglyrp1.
Recombinant Mouse Peptidoglycan Recognition Protein 1 (PGLYRP1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11188P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Peptidoglycan Recognition Protein 1 (PGLYRP1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O88593 |
Target Symbol | PGLYRP1 |
Synonyms | Pglyrp1; Pglyrp; Pgrp; Pgrps; Tag7; Peptidoglycan recognition protein 1; Cytokine tag7; Peptidoglycan recognition protein short; PGRP-S |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE |
Expression Range | 19-182aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 26.2 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity. Forms an equimolar complex with heat shock protein HSPA1A and induces programmed cell death through apoptosis and necroptosis in tumor cell lines by activating the TNFR1 receptor on the target cell membrane. In addition, acts in complex with the Ca(2+)-binding protein S100A4 as a chemoattractant able to induce lymphocyte movement. Mechanistically, this complex acts as a ligand of the chemotactic receptors CCR5 and CXCR3 which are present on the cells of the immune system. Promotes also the activation of lymphocytes that become able to kill virus-infected cells as well as tumor cells by modulating the spectrum of their cell specificity. Induction of cytotoxicity on monocyte surface requires interaction with TREM1 receptor. |
Subcellular Location | Cytoplasm. Secreted. Note=Exists in both soluble and membrane-associated forms. |
Protein Families | N-acetylmuramoyl-L-alanine amidase 2 family |
Database References | KEGG: mmu:21946 STRING: 10090.ENSMUSP00000032573 UniGene: PMID: 29083508 |