Recombinant Mouse Parvalbumin Alpha (PVALB) Protein (His&Myc)

Name: Recombinant Mouse Parvalbumin Alpha (PVALB) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-07034P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Parvalbumin Alpha (PVALB) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P32848
Target Symbol	PVALB
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	SMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLVAES
Expression Range	2-110aa
Protein Length	Full Length of Mature Protein
Mol. Weight	19.2 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
Protein Families	Parvalbumin family
Database References	KEGG: mmu:19293 STRING: 10090.ENSMUSP00000005860 UniGene: Mm.2766

Gene Functions References

Data indicate that fast-spiking interneurons which typically express parvalbumin (PV) show greater firing coherence with CA1 network oscillations. PMID: 28382952
Martinotti cells in layers II/III of the mouse primary somatosensory cortex are inhibited by both parvalbumin (PV)- and vasoactive intestinal polypeptide (VIP)-expressing cells. PMID: 27897179
Synapses from parvalbumin-expressing interneurons onto hippocampal pyramidal neurons are regulated by neuronal firing, signaling through L-type calcium channels. PMID: 29295931
This study investigated the distribution of Ca2+-binding proteins (CaBPs), such as calbindin D28k, parvalbumin, and calretinin, in the Superior Olivary Complex of the circling mouse on postnatal day 16. PMID: 29130968
Axotomy Leads to Reduced Calcium Increase and Upregulated Parvalbumin Followed by Decreased Neighboring Microglial Activation. PMID: 28017131
reduction of PV(+) neurons was in all cases, i.e., in PV+/-, Shank1-/- and Shank3B-/- mice, was due to a reduction in Pvalb mRNA and PV protein PMID: 26819149
The calcium-binding protein parvalbumin (PV) is a crucial marker in defining the most predominant interneuron subtype within the cerebral cortex. PMID: 26882036
dysfunction of parvalbumin positive interneurons signaling in the prefrontal cortex (PFC) specifically produces deficits in the cognitive domain, but does not give rise to PFC-dependent correlates of negative or positive symptoms. PMID: 26608841
Thus PV+ GP neurons are synaptically positioned to directly coordinate activity between BG input nuclei, the striatum and STN, and thalamic-output from the SNr. PMID: 26905595
These findings confirm that fate determination of cortical interneurons subgroups is crucially influenced by Shh signaling, and provide a system for the further study of interneuron fate and function. PMID: 25804737
Parvalbumin and Npas1 neurons have different topologies within the basal ganglia. PMID: 26311767
Nearly all parvalbumin interneurons express Lynx1 did not detect Lypd6 in this population. Conversely, in somatostatin interneurons Lypd6 was found in a subset localized to deep cortical layers but no somatostatin neurons show detectable levels of Lynx1. PMID: 25359633
Our data indicate that the injury-triggered up-regulation of PV-expression is mediated by inflammatory cytokines, and promotes the motility and adhesion of ependymal cells. PMID: 25421913
There was a significant correlation between Y-maze performance and PV expression in the dorsal hippocampus in WT mice, but no such correlation in BDNF+/- mice. PMID: 25603414
EF-hand Ca(2+) buffers regulate presynaptic IHC function for metabolically efficient sound coding. PMID: 25691754
Fgfr1 inactivation in the mouse telencephalon results in impaired maturation of interneurons expressing parvalbumin. PMID: 25116473
This study demonistrated that Early- and late-born parvalbumin basket cell subpopulations exhibiting distinct regulation and roles in learning. PMID: 25695271
Impaired excitability of somatostatin- and parvalbumin-expressing cortical interneurons in a mouse model of Dravet syndrome. PMID: 25024183
This study demonistrated that the developmental trajectory of parvalbumin- and calretinin-positive interneurons along the dorso-ventral and rostro-caudal axes of the ventral hippocampus in juvenile, adolescent, and adult rats. PMID: 23893875
Suppression of excitatory parvalbumin-positive fast spiking interneurons in the prelimbic area may enhance reward-related behavioral flexibility. PMID: 24599468
Parvalbumin tunes spike-timing and efferent short-term plasticity in striatal fast spiking interneurons. PMID: 23551945
The results of this study suggested a niche mechanism involving parvalbumin interneurons that couples local circuit activity to the diametric regulation of two critical early phases of adult hippocampal neurogenesis. PMID: 24212671
This study demonistrated that Parvalbumin-expressing inhibitory interneurons in auditory cortex are well-tuned for frequency in mice. PMID: 23966693
These results suggest the fact that the maintenance of parvalbumin expression is mediated to the neuroprotective function of nicotinamide against ischemic brain injury. PMID: 23047329
We failed to provide proof-of-concept evidence that lower PV and GAT1 expression in schizophrenia are a consequence of lower GAD67 expression PMID: 23103418
The rapid spiking inhibitory interneurons that co-express PV are involved in shaping neural responses to fast spectrotemporal modulations. We examined cortical PV expression in the C57bl/6 mouse, a strain commonly studied as a presbycusis model. PMID: 23010334
In a circling mouse model of deafness, there is a decrese in expression of parvalbumin in the hippocampus. PMID: 22226504
Increase in NF-kappaB activation coincides with increased reactive oxygen species production and decreased parvalbumin expression in parvalbumin-interneurons in vitro. PMID: 21378588
The results of this study indicated that PV cells are ideally suited to modulate cortical gain and establish a causal relationship between a select neuron type and specific computations performed by the cortex during sensory PMID: 22243754
phenotype of mice with GABA(A) receptor gamma2 subunits from parvalbumin neurons PMID: 21912668
Our work indicates that parvalbumin and the cannabinoid-1 (CB1) receptor might be far more intricately related than previously thought. PMID: 21445945
The relative mean density of calbindin and parvalbumin immunoreactivity in the Purkinje cell layer is significantly decreased in the homozygous cir/cir genotype, compared with the wild-type. PMID: 20691752
Data show that parvalbumin-positive interneurons are dispensable for spatial reference, but are essential for spatial working memory. PMID: 21278730
These data provide more direct evidence of the protective role of parvalbumin against the degeneration mediated by a calcium increase in the acute injury of motor neurons. PMID: 20394052
Data conclude that GPx4 is a selenoenzyme modulating interneuron function and parvalbumin expression. PMID: 19890015
The expression of PV and its colocalization with neuronal nitric oxide synthase have been determined in different populations of hippocampal GABAergic neurons. PMID: 12115690
Parvalbumin deficiency, due to an increased short-term facilitation of GABA release, enhances inhibition by high-frequency burst-firing PV-expressing interneurons and may affect the higher cognitive functions associated with gamma oscillations. PMID: 12626620
The slight aggravation of muscle dystrophy observed in mdx mice deprived of parvalbumin cannot explain the severity of the affection observed in xmd dogs and Duchenne dystrophy patients where parvalbumin is constitutively not expressed. PMID: 12798793
Distinct kinetics of parvalbumin and calbindin D28k underlie biphasic kinetics of synaptically evoked Ca2+ transients in dendritic shafts of Purkinje cells. PMID: 12813159
This study conclude that alterations in the Ca(2+) homeostasis present in mice ectopically expressing neuronal PV are more deleterious under excitotoxic stress PMID: 14980812
Parvalbumin arises as a major contributor to presynaptic Ca(i) signals and synaptic integration in the cerebellar cortex. PMID: 15634771
Retinal illumination had opposite effects on levels of parvalbumin and oxytocin and decreased parvalbumin staining in the cilia. PMID: 15964694
These results demonstrate that the absence of the parvalbumin disrupts the regulation of Purkinje cell firing rate and rhythmicity. PMID: 16115209
Quantitative analysis of selected mitochondrial proteins revealed the PV-/- tibialis anterior mitochondria composition to be almost identical to that in wild-type soleus, but not in wild-type fast-twitch muscles. PMID: 16367751
Density of parvalbumin-positive neurons does not alter during cortical plasticity in classical conditioning. PMID: 16413119
Calcium-binding proteins may contribute to selective vulnerability and an early loss of function of large motor neurons in this SOD1-transgenic mouse model. PMID: 16546142
In-strain embryo transfer had a differential influence on the numbers of amygdaloid parvalbumin-immunoreactive neurons of inbred C3H/HeN and DBA/2J mice. Maternal factors had a some impact on the numbers of PARV-ir neurons. PMID: 16860404
The firing properties of four subtypes of parvalbumin-positive interneurons allow the neuron networks to perform an array of information-processing tasks within the basolateral amygdala. PMID: 17234587
Analysis revealed a slightly increased activity in mice lacking parvalbumin as well as an increase in the characteristic speed during the first 8 day. PMID: 17275105
Our results indicate that CB, PV and GABA show a dynamic pattern of colocalization in cells of the mouse basolateral amygdalar nucleus throughout development. PMID: 17681450

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.