Recombinant Mouse Oxytocin-Neurophysin 1 (OXT) Protein (His&Myc)

Name: Recombinant Mouse Oxytocin-Neurophysin 1 (OXT) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-11021P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Oxytocin-Neurophysin 1 (OXT) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P35454
Target Symbol	OXT
Synonyms	Oxt; Oxytocin-neurophysin 1; OT-NPI) [Cleaved into: Oxytocin; Ocytocin); Neurophysin 1]
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	AVLDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER
Expression Range	32-125aa
Protein Length	Partial
Mol. Weight	17.1 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR).
Protein Families	Vasopressin/oxytocin family
Database References	KEGG: mmu:18429 STRING: 10090.ENSMUSP00000028764 UniGene: PMID: 28715127 Data indicate that oxytocin participates in the spine remodeling, synaptic refinement, and social stimuli-dependent plasticity in the posterodorsal medial amygdala of male mice. PMID: 28889007 Activation of the oxytocin receptor in brain regions facilitates social defeat posture. PMID: 29186377 the absence of OT leads to significant changes in the expression of the studied genes (OTR, ERalpha, ERbeta, V1aR), and these changes may contribute to the decreased sexual behavior observed in OT gene knockout females. PMID: 27558735 These results reveal that Oxt protects pancreatic beta cells against death caused by metabolic stress, and Oxt signaling may be a potential therapeutic target. PMID: 27143105 CA3 pyramidal cells in the adult mouse hippocampus express OXT receptors and receive inputs from hypothalamic OXT neurons. PMID: 28912554 These results identify G9a-induced histone methylation at the OXT and AVP promoters in the Basolateral Amygdala as a mechanism for mediating stress-induced lasting behavioral depression and its reversal by exercise. PMID: 25863961 Data indicate that oxytocin is an important synaptic modulator in the posterodorsal medial amygdala, a finding that is likely involved with the display of the female sexual behavior. PMID: 26163772 OXT was up-regulated in both hypothalamic magnocellular neurosecretory cells and parvocellular cells by chronic inflammation, and also that OXT in the PVN-spinal pathway may be involved in sensory modulation PMID: 25943916 role for a neuronal population in the control of maternal care and oxytocin secretion; and evidence for a causal relationship between sexual dimorphism in the adult brain and sex differences in parental behaviour PMID: 26375004 Oxtr signaling is crucial for entrainment of odor to social cues but is dispensable for entrainment to nonsocial cues. Oxt conveys saliency of social stimuli to sensory representations in the piriform cortex during odor-driven social learning. PMID: 26139372 Oxytocin is is required for proper muscle tissue regeneration and homeostasis, and that plasma levels of oxytocin decline with age. Genetic lack of oxytocin does not cause a developmental defect in muscle but instead leads to premature sarcopenia. PMID: 24915299 results describe fundamental synaptic mechanisms by which oxytocin increases the salience of acoustic social stimuli; furthermore, oxytocin-induced plasticity provides a biological basis for lateralization of auditory cortical processing PMID: 25874674 Results show that OT inhibits appetite for carbohydrates; sucrose consumption considerably enhances OT gene expression and is particularly sensitive to OT receptor blockade PMID: 24893201 Data suggest that oxytocin plays a crucial role in the sexual behavior display, number of released oocytes and density of dendritic spines in the MePD of female mice without affecting AVP plasma concentration PMID: 23906766 lactic acid microbes accelerate wound healing via the neuropeptide hormone oxytocin PMID: 24205344 CD38 in the nucleus accumbens and oxytocin are critical in paternal behavior. PMID: 24059452 A new form of plasticity is identified in neonatal mice, when early sensory experience cross-modally regulates development of all sensory cortices via oxytocin signaling. PMID: 24464043 the rewarding properties of social interaction in mice require the coordinated activity of oxytocin and 5-HT in the nucleus accumbens--with implications for understanding the pathogenesis of social dysfunction in neuropsychiatric disorders like autism PMID: 24025838 data suggest that OT modulates social investigation behavior and the aggressiveness of male mice. T PMID: 23376700 Oxytocin pathways may not be essential for regulating voluntary sodium ingestion. PMID: 22784207 medial amygdala likely modulates hostile aggressive behavior associated with immediate early gene expression in OXT and vasopressin neurons PMID: 23403283 these results support the hypothesis that the expression of the mouse oxytocin receptor gene is epigenetically regulated by DNA methylation of its promoter. PMID: 23441222 We conclude that Maged1 is required for oxytocin processing or stability. A decrease in mature OT levels in Maged1 mutants affects social interactions and possibly other behavioral processes PMID: 22865874 OT release in bone marrow by a rising estrogen concentration may facilitate rapid skeletal recovery during the latter phases of lactation. PMID: 22761429 We consider hypotheses of the roles played by central and systemic OT release as well as their control and modulation in the female in mating and pregnancy--REVIEW PMID: 22107910 we describe data detailing the molecular mechanism of CD38-dependent OXT secretion in CD38 knockout mice--REVIEW PMID: 22227279 results support the idea that variation in ovarian hormones could be related to individual differences in social recognition, at least partly through modulation of the OT and/or AVP systems, particularly in the DS, LA and MPOA. PMID: 22079582 The data suggested that vasopressin or oxytocin exert a minimal effect on most GABA neurons in the lateral hypothalamus but exert a robust excitatory effect on presumptive GABA cells that contain melanin-concentrating hormone. PMID: 22262306 there is a local feed-forward loop in bone marrow through which the OT so produced from osteoblasts in response to estrogen acts upon its receptor to exert a potent anabolic action. PMID: 21741363 Oxytocin plays a pivotal role in mediating the adaptation mechanism following chronic homotypic stress in mice. PMID: 21439349 Fto, a proposed transcription co-factor, influences expression of the gene encoding a satiety mediator, oxytocin. PMID: 21514276 Recently a new tool has been created that has furthered our understanding of oxytocin's role in behavior: transgenic mice that lack either the ability to synthesize oxytocin or the oxytocin receptor itself--REVIEW PMID: 20732312 global reduction in FGF8 signaling leads to an overall reduction of mature OT and oxyphysin prohormone levels that may have resulted from defects in multiple stages of the hormone-synthesis pathway PMID: 21046478 central oxytocin plays a pivotal role in mediating the adaptation mechanism following repeated restraint stress in mice PMID: 20969650 Oxytocin acts as a carbohydrate-specific inhibitor of feeding. PMID: 20685878 OXT elicits Ca2+ signals via OXTR in murine taste buds PMID: 20700536 Data show that EBs expressed Oct-4, OTR, OT, and DAZL. PMID: 19695304 The upregulation of central oxytocin expression is involved in mediating the adaptation mechanism following chronic repeated stress in mice. PMID: 19889866 oxytocin mediates stress-induced analgesia PMID: 11956346 The OT/OTR system plays an important role in cardiogenesis by promoting cardiomyocyte differentiation. PMID: 12093924 Results suggest that estrogen receptor-beta activation may play a critical role in estrogenic regulation of oxytocin and arginine vasopressin gene expression in the paraventricular nucleus. PMID: 12531518 OT is 1)involved in tonic blood pressure maintenance; 2)extends the functional range of arterial baroreceptor reflex; 3)reduces the sympathetic reserve PMID: 12531722 required for mammalian social recognition, through which an individual learns to recognize other individuals PMID: 12730370 that OT pathways play a role in modulating anxiety in female mice of the C57BL/6 background, and the effect is mediated by the OT receptor. PMID: 12746288 oestrogen-dependent regulation of oxytocin and vasopressin synthesis in the paraventricular hypothalamic nucleus is mediated by ERbeta. PMID: 12834440 Blood oxytocin concentrations on d 9 postpartum were also lower in Usf2-/- mice than Usf2+/+ mice PMID: 12907752 Regulatory element in the intergenic region of the oxytocin gene controls hypothalamus-specific expression. PMID: 12944509 Oxytocin plays a role in the regulation of blood pressure and salt appetite. PMID: 12953013 OT signaling pathways are unnecessary for the anorexigenic effects of systemically administered CCK and d-fenfluramine in C57BL/6 mice. PMID: 14557235

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.