Recombinant Mouse Nuclear Receptor Ror-Gamma (RORC) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10799P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Nuclear Receptor Ror-Gamma (RORC) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10799P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Nuclear Receptor Ror-Gamma (RORC) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P51450
Target Symbol RORC
Synonyms Rorc; Nr1f3; Rorg; Thor; Nuclear receptor ROR-gamma; Nuclear receptor RZR-gamma; Nuclear receptor subfamily 1 group F member 3; RAR-related orphan receptor C; Retinoid-related orphan receptor-gamma; Thymus orphan receptor; TOR
Species Mus musculus (Mouse)
Expression System Yeast
Tag N-6His
Target Protein Sequence MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
Expression Range 1-516aa
Protein Length Full Length
Mol. Weight 60.1kDa
Research Area Epigenetics And Nuclear Signaling
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. Regulates the circadian expression of clock genes such as CRY1, ARNTL/BMAL1 and NR1D1 in peripheral tissues and in a tissue-selective manner. Competes with NR1D1 for binding to their shared DNA response element on some clock genes such as ARNTL/BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORC-mediated activation of the expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock. Involved in the regulation of the rhythmic expression of genes involved in glucose and lipid metabolism, including PLIN2 and AVPR1A. Negative regulator of adipocyte differentiation through the regulation of early phase genes expression, such as MMP3. Controls adipogenesis as well as adipocyte size and modulates insulin sensitivity in obesity. In liver, has specific and redundant functions with RORA as positive or negative modulator of expression of genes encoding phase I and Phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as SULT1E1. Also plays also a role in the regulation of hepatocyte glucose metabolism through the regulation of G6PC1 and PCK1. Regulates the rhythmic expression of PROX1 and promotes its nuclear localization.; Essential for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes and Peyer's patches. Required for the generation of LTi (lymphoid tissue inducer) cells. Regulates thymocyte survival through DNA-binding on ROREs of target gene promoter regions and recruitment of coactivaros via the AF-2. Also plays a key role, downstream of IL6 and TGFB and synergistically with RORA, for lineage specification of uncommitted CD4(+) T-helper (T(H)) cells into T(H)17 cells, antagonizing the T(H)1 program. Probably regulates IL17 and IL17F expression on T(H) by binding to the essential enhancer conserved non-coding sequence 2 (CNS2) in the IL17-IL17F locus. May also play a role in the pre-TCR activation cascade leading to the maturation of alpha/beta T-cells and may participate in the regulation of DNA accessibility in the TCR-J(alpha) locus. Plays an indispensable role in the induction of IFN-gamma dependent anti-mycobacterial systemic immunity.
Subcellular Location Nucleus.
Protein Families Nuclear hormone receptor family, NR1 subfamily
Database References

KEGG: mmu:19885

STRING: 10090.ENSMUSP00000029795

UniGene: PMID: 28978473

  • the potential effects of the A2A adenosine receptor (A2AR) antagonist SCH 5826 (SCH) and agonist CGS 21680 (CGS) on behavior (self-grooming), hot plate test results, and expression levels of IL-17A(+), RORgammat(+), Foxp3(+), and IL-10(+) in CD4(+) T spleen cells in BTBR and C57BL/6 (B6) mice, were investigated. PMID: 28438638
  • pharmacological inhibition of RORgamma skews TCRalpha gene rearrangement, limits T cell repertoire diversity, and inhibits development of autoimmune encephalomyelitis.targeting RORgammaT not only inhibits Th17 cell development and function but also fundamentally alters thymic-emigrant recognition of self and foreign antigens. PMID: 28009290
  • RORgamma mediates epithelial-mesenchymal transition of hepatocytes during hepatic fibrosis facilitated by TGFbeta1. PMID: 27791279
  • Heterozygous deletion of RORgammat gene resulted in aggravated cardiac remodeling, accompanied by reduced capillary density, after MI, suggesting that RORgammat-expressing cells contribute to tissue repair in infarcted myocardium PMID: 28827845
  • IKKalpha-dependent phosphorylation of S376 stimulated whereas IKKalpha-independent phosphorylation of S484 inhibited RORgammat function in Th17 differentiation. PMID: 28667162
  • we identified a two-amino-acid substitution in RORgammat (RORgammat(M)) that 'preferentially' disrupted TH17 differentiation but not thymocyte development. Mice expressing RORgammat(M) were resistant to EAE associated with defective TH17 differentiation but maintained normal thymocyte development and normal lymph-node genesis, except for Peyer's patches. PMID: 28846085
  • secretion of IL-17 by biTregs was abrogated completely in FoxP3(Cre) x RORC(fl/fl) mice. Furthermore, Tregs showed a more activated phenotype after cell-specific inactivation of RORgammat signalling. Finally, and remarkably, biTregs were found to potently suppress anti-inflammatory Th2 immunity in a RORgammat-dependent manner. PMID: 27880975
  • this paper shows that RORgammat antagonist, A213 suppresses Sjogren's syndrome-like sialadenitis PMID: 27643385
  • this study reveales a new mechanism through which procyanidin B2 gallates inhibit IFN-gamma and IL-17 production in T cells by down-regulation of T-bet and RORgammat expression PMID: 28088699
  • The data suggest that RORgt expression in Tregs contributes to an optimal suppressive capacity during gut-specific immune responses, rendering Foxp3-RORgt T cells as an important effector Treg subset in the intestinal system. PMID: 26307665
  • up-regulated expression in abortion mouse model PMID: 26474535
  • Rag-RORgammat-reporter and Rag KO mice undergoing ischemia reperfusion injury expressed high protein levels of both IL-22 and GFP (RORgammat) PMID: 26341825
  • Overexpression of RORgammat Enhances Pulmonary Inflammation after Infection with Mycobacterium Avium. PMID: 26784959
  • Results reveal differential requirements for ROR-gammat in the maintenance of TH17 cell and group 3 innate lymphoid cell responses in intestinal inflammation. PMID: 26878233
  • Binding at this non-canonical site induces an unprecedented conformational reorientation of helix 12 in the RORgammat ligand binding domain. PMID: 26640126
  • injected chlorhexidine gluconate into wild-type, T-bet Tg, GATA-3 Tg, and RORgammat Tg mice and analyzed body weight on day 21 PMID: 26156402
  • Dysregulated development of IL-17- and IL-21-expressing follicular helper T cells and increased germinal center formation in the absence of RORgammat. PMID: 26499265
  • BET bromodomains are involved in psoriasis-like inflammation through induction of RORC/IL-17A pathway. PMID: 26149470
  • High-fat diet - induced type 2 diabetes decreases the number of ileum IL17/RORgammaT CD4 T cells. PMID: 26154056
  • These results suggest that both RORgammat-overexpressed CD4(+) T cells and reduced Treg cells might contribute to the development of Sjogren's syndrome -like sialadenitis. PMID: 25411202
  • study reports that microbiota-induced T(regs) express RORgammat and differentiate along a pathway that also leads to T(H)17 cells; in the the absence of RORgammat+ Tregs, TH2-driven defense against helminths is more efficient, whereas TH2-associated pathology is exacerbated PMID: 26160380
  • study found Rorgamma, and the T(regs) that express it, contribute substantially to regulating colonic T(H)1/T(H)17 inflammation; the marked context-specificity of Rorgamma results in very different outcomes even in closely related cell types PMID: 26272906
  • mucosal draining lymph nodes express CCR7, which has a role in trafficking of RORgamma innate lymphoid cells PMID: 25575242
  • RORgammat overexpression in T cells protected against the development of CIA. PMID: 25928901
  • Data indicate that ablation of retinoic-acid-related orphan receptor (RORC1/RORgamma) in the hematopoietic compartment prevented cancer-driven myelopoiesis, resulting in inhibition of tumor growth and metastasis. PMID: 26267538
  • We conclude that Foxo1 is a direct antagonist of the RORgammat-Th17 program acting in a T cell-intrinsic manner. PMID: 26170390
  • IL-23 plus T-cell receptor signalling results in significant upregulation of IL-23 receptor expressed predominantly on CD4(hi)CD8(hi)CD3(+)alphabetaTCR(+) thymocytes, and leads to RORgammat-dependent apoptosis. PMID: 25001511
  • TF enhances expression of genes for transcription factor RORgammat. The enhanced expression of the RORgt gene corresponds with an increase in the number of RORgammatCD4 Th17 cells and with enhanced IL-17 production. PMID: 25629265
  • Data indicate that the retinoic acid receptor-related orphan nuclear receptor gammat (RORgammat) inverse agonist TMP778 blocks interleukin-17A-secreting T helper type 17 (Th17) cell differentiation. PMID: 25604624
  • These results indicate an important role for the immunological milieu in colitis-associated cancer, which is shaped in-part by RORgammat-dependent Th17 lymphocytes that support CRC growth. PMID: 25820779
  • Sirtuin 1 (SIRT1), a protein deacetylase previously reported to have an antiinflammatory function, in fact promotes autoimmunity by deacetylating RORgammat, the signature transcription factor of Th17 cells. PMID: 25918343
  • These results demonstrate that estradiol upregulates REA expression and recruits REA via ERalpha to the EREs on the RORgammaT promoter region, thus inhibiting RORgammaT expression and Th17 differentiation. PMID: 25769926
  • RORgammat-specific transcriptional interactomic inhibition suppresses autoimmunity associated with TH17 cells. PMID: 25527718
  • The study indicates that RORgamma functions as an important link between the circadian clock and the transcriptional regulation of several metabolic genes. PMID: 25143535
  • Transcription of RORgammat in developing Th17 cells is regulated by E-proteins. PMID: 24064669
  • The inhibition of the activation of several metabolic gene promoters by an RORgamma antagonist suggests that antagonists may provide a novel strategy in the management of metabolic diseases, including type 2 diabetes PMID: 24831725
  • miR-20b suppresses Th17 differentiation and the pathogenesis of experimental autoimmune encephalomyelitis by targeting RORgammat and STAT3. PMID: 24842756
  • Data indicate that CD5-casein kinase 2 (CK2) signaling is necessary for efficient nuclear localization of orphan nuclear receptor ROR-gammaT (RORgammat). PMID: 24356888
  • Data suggest that RORgammat is a tractable drug target for the treatment of cutaneous inflammatory disorders. PMID: 24516202
  • Gata3 plays a generalized role in innate lymphoid cell (ILC) lineage determination and is critical for the development of gut RORgammat(+) ILC3 subsets that maintain mucosal barrier homeostasis. PMID: 24419270
  • IL-22-producing RORgammat-dependent innate lymphoid cells play a novel protective role in murine acute hepatitis. PMID: 23626860
  • RORgammat+IL-17+ neutrophils play a critical role in hepatic ischemia-reperfusion injury. PMID: 23362310
  • Unconventional and double-negative T cells are major RORgammat-expressing effector cells that play a mechanistic role in early ischemia reperfusion injury. PMID: 23740948
  • RORgammat has a central role in determining the balance between protective and pathogenic regulatory T cells in colorectal cancer. PMID: 23241743
  • RORgammat-deficient Rag- 2-/- mice developed more severe DSS-induced colitis accompanied with lower expression of REG3b and REG3gamma in the colon. PMID: 23022186
  • RORgammat-overexpressing mice developed steroid-insensitive neutrophilic inflammation under Th17-biased conditions. Neutrophil chemotaxis-related mediators were elevated in OVA-exposed RORgammat-overexpressing mice. PMID: 23293351
  • Results demonstrate that the lack of retinoic acid-related orphan receptor gamma expression in mice significantly reduced the peak expression level of Cry1, Bmal1, E4bp4, Rev-Erbalpha and Per2 in a tissue-selective manner without affecting the phase of their rhythmic expression. PMID: 22753030
  • These results suggest that ROR-gamma-t plays important roles in the development of plasmacytosis and autoantibody production. PMID: 22623033
  • CD4(+) T cell expression of RORgammat is important in the pathogenesis of acute Graft-versus-host disease. PMID: 22778391
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed