Recombinant Mouse Non-Receptor Tyrosine-Protein Kinase Tyk2 (TYK2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07394P

Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Non-Receptor Tyrosine-Protein Kinase Tyk2 (TYK2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07394P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Non-Receptor Tyrosine-Protein Kinase Tyk2 (TYK2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9R117 |
Target Symbol | TYK2 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | SDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMTVLRLTELLERGERLPRPDRCPCEIYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQ |
Expression Range | 884-1174aa |
Protein Length | Partial |
Mol. Weight | 41.2 kDa |
Research Area | Microbiology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Non-receptor kinase involved in various processes including cell growth, development, cell migration, innate and adaptive immunity. Plays both structural and catalytic roles in numerous cytokines and interferons signaling. Associates with cytokine and growth factor receptors and activate STAT family members including STAT1, STAT3, STAT4 or STAT6. The heterodimeric cytokine receptor complexes are composed of a TYK2-associated receptor chain (IFNAR1, IL12RB1, IL10RB or IL13RA1) which serves as the signal transducing chain harboring STAT docking sites once phosphorylated by TYK2, and a second receptor chain associated either with JAK1 or JAK2. In turn, recruited STATs are phosphorylated, form homo- and heterodimers, translocate to the nucleus, and regulate cytokine/growth factor responsive genes. Negatively regulates STAT3 activity by promototing phosphorylation at a specific tyrosine that differs from the site used for signaling. |
Protein Families | Protein kinase superfamily, Tyr protein kinase family, JAK subfamily |
Database References | KEGG: mmu:54721 STRING: 10090.ENSMUSP00000001036 UniGene: PMID: 27807284 |