Recombinant Mouse Non-Receptor Tyrosine-Protein Kinase Tyk2 (TYK2) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-07394P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Mouse Non-Receptor Tyrosine-Protein Kinase Tyk2 (TYK2) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-07394P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Non-Receptor Tyrosine-Protein Kinase Tyk2 (TYK2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q9R117
Target Symbol TYK2
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence SDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMTVLRLTELLERGERLPRPDRCPCEIYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQ
Expression Range 884-1174aa
Protein Length Partial
Mol. Weight 41.2 kDa
Research Area Microbiology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Non-receptor kinase involved in various processes including cell growth, development, cell migration, innate and adaptive immunity. Plays both structural and catalytic roles in numerous cytokines and interferons signaling. Associates with cytokine and growth factor receptors and activate STAT family members including STAT1, STAT3, STAT4 or STAT6. The heterodimeric cytokine receptor complexes are composed of a TYK2-associated receptor chain (IFNAR1, IL12RB1, IL10RB or IL13RA1) which serves as the signal transducing chain harboring STAT docking sites once phosphorylated by TYK2, and a second receptor chain associated either with JAK1 or JAK2. In turn, recruited STATs are phosphorylated, form homo- and heterodimers, translocate to the nucleus, and regulate cytokine/growth factor responsive genes. Negatively regulates STAT3 activity by promototing phosphorylation at a specific tyrosine that differs from the site used for signaling.
Protein Families Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Database References

KEGG: mmu:54721

STRING: 10090.ENSMUSP00000001036

UniGene: PMID: 27807284

  • Results show that loss of TYK2 does not affect disease severity of JAK2VF-induced murine myeloproliferative neoplasms (MPN) indicating that TYK2 has no cooperative effects with JAK2VF at the onset of MPN. PMID: 28668884
  • mutated form which lacks tyrosine kinase activity restores differentiation of brown preadipocytes PMID: 27802075
  • Decreased Tyk2 expression in pancreatic beta cells due to mutation determines susceptibility to virus-induced diabetes mellitus. PMID: 25849081
  • A reduced survival fitness of the Th17 in the absence of Tyk-2 mediated by the up-regulation of SOCS3. PMID: 25109392
  • Data indicate the important role of Tyk2 in skin inflammation and the therapeutic potential of Tyk2 inhibition in psoriasis. PMID: 24345760
  • The conditional Tyk2 mouse strain will be instrumental to further dissect TYK2 functions in infection, inflammation and cancer. PMID: 24696087
  • this report identifies Tyk2 as a prerequisite factor in the molecular networks that are involved in generation of IL-27. PMID: 24604832
  • Tyk2-mediated IL-12 signaling is differentially required for the development of different Th1 cell subsets but similarly induces their bystander IFN-gamma production PMID: 24729620
  • Expression of Tyk2 or the constitutively active form of the transcription factor Stat3 (CAStat3) restores differentiation in Tyk2(-/-) brown preadipocytes. PMID: 23217260
  • The first mouse Tyk2 crystal structures, which are complexed to 3-aminoindazole compounds, are described. PMID: 22995073
  • The results provide the first evidence for a role of Tyk2 in suppressing the growth and metastasis of breast cancer. PMID: 21864028
  • important functions of Tyk2 at the molecular interface between innate immunity and cellular metabolism. PMID: 21787891
  • gene deficiency protects joints against destruction in anti-type II collagen antibody-induced arthritis PMID: 21765170
  • The consequent effect of SOCS1 inhibition of Tyk2 not only results in a reduced IFN response because of inhibition of Tyk2 kinase-mediated STAT signaling but also negatively impacts IFNAR1 surface expression, which is stabilized by Tyk2. PMID: 21757742
  • A negative regulatory function is found for Tyk2 that controls IL-1ss expression in response to lipopolysaccharide at the level of translation and is probably dependent on canonical type I interferon signaling. PMID: 20713887
  • Findings suggest an important regulatory role for Tyk2 in modulating the relationship between immunity and metabolism. PMID: 20338026
  • Tyk2 is a Janus kinase that plays a central role in controlling the T(H)1 immune response and attenuation of Tyk2 function correlates with enhanced central nervous system repair. PMID: 20080754
  • requirement for tyk2 for IL-12-induced NK cell activity, and for IL-18-induced NK cell activity and IFN-gamma production PMID: 11877284
  • Tyk2 is essential for IFN-alpha-induced B lymphocyte growth inhibition, through the up-regulation and nuclear translocation of DAXX. PMID: 12391177
  • Tyk2 plays a bilateral role in allergic inflammation in the airways by regulating Th1/Th2 balance toward the Th1-type, while it is required for induction of IL-13-mediated goblet cell hyperplasia in the airways. PMID: 12517976
  • Data show that Tyk2 tyrosine kinase is essential for stable cell surface expression of IFNAR1. PMID: 12554654
  • Differential requirements for JAK2 and TYK2 in T cell proliferation and IFN-gamma production induced by IL-12 alone or together with IL-18. PMID: 12594853
  • Tyk2 and IFN-beta are essential effectors in LPS induced lethality. PMID: 12679810
  • role for Tyk2 in T helper 1-mediated protective and pathogenic immune responses PMID: 14500783
  • Limitin suppresses B-cell growth through activation of Tyk2, resulting in the up-regulation and nuclear translocation of Daxx PMID: 14662340
  • Tyk2 is necessary for NK cell cytotoxic activity and early production of IFN-gamma by NK cells and CD8-positive T cells in L. major-infected mice but dispensable for the development of Th1 cells and for ultimate control of the infection. PMID: 14768057
  • Tyk2 is essential for LPS-induced endotoxin shock, and this signaling pathway is transduced by the activation of Stat1 and Stat4. PMID: 15226272
  • Tyk2 has a role in hapten-induced contact hypersensitivity in a mouse model PMID: 15488705
  • study shows that TYK2-/- mice are tumor prone and links the increased tumor susceptibility to tumor surveillance; define TYK2 as a key molecule in B lymphoid malignancy PMID: 15578097
  • In addition to the established role of Tyk2 as an amplifier of Jak/Stat signaling upon IFN-alphabeta stimulation, there is a novel role of Tyk2 as a modifier of host responses PMID: 16148148
  • Tyk2 is critical for optimal IL-10-mediated signaling and suppressor function. PMID: 16751369
  • Our results implicate a novel role for Tyk2 kinase and Stat3 phosphorylation in mitochondrial respiration. PMID: 16982690
  • The defective Tyk2 signaling in the host environment was at least partially responsible for the impaired CD8+ T cytotoxic-1 (Tc1) cell responses in Tyk2-/- mice following the infection. PMID: 17048270
  • Tyk2 signaling for IFN-gamma production in host environment plays an important role in contraction of effector CD8+ T cells following a microbial infection. PMID: 17372006
  • Expression of Tyk2 in dendritic cellss is crucial for the production of Th1-promoting cytokines such as IL-12 and IFN-gamma. PMID: 17395783
  • data suggest iNOS (inducible nitric oxide synthase) is induced through IFNAR1 & TYK2 in Mac3-positive cells, the main source of iNOS in spleen and lung; LPS-induced iNOS expression in liver is independent of IFNAR1 & partially dependent on TYK2 PMID: 18086385
  • Tumor-induced suppressor of cytokine signaling 3 inhibits toll-like receptor 3 signaling in dendritic cells via binding to tyrosine kinase 2. PMID: 18593942
  • Tyk2-signaling is critical for IL-23-induced IL-17 production by gammadelta T cells PMID: 18641345
  • The data suggest a selective contribution of Tyk2 to the activation of inflammation-relevant cell types by LPS. PMID: 18845149
  • Tyk2 is a shared autoimmune disease susceptibility gene whose genetic contribution to disease susceptibility can be modified by environmental factors PMID: 19494301
  • Tyk2 is critically involved in the pathogenic CD4 T cell responses in experimental autoimmune encephalomyelitis PMID: 19917699
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed