Recombinant Mouse Neuropeptide Y Receptor Type 2 (NPY2R) Protein (His-SUMO&Myc)

Name: Recombinant Mouse Neuropeptide Y Receptor Type 2 (NPY2R) Protein (His-SUMO&Myc)
Brand: Beta LifeScience
SKU: BLC-07964P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Neuropeptide Y Receptor Type 2 (NPY2R) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P97295
Target Symbol	NPY2R
Synonyms	Npy2r; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His-SUMO&C-Myc
Target Protein Sequence	MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV
Expression Range	1-51aa
Protein Length	Extracellular Domain
Mol. Weight	25.5 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for neuropeptide Y and peptide YY.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	KEGG: mmu:18167 STRING: 10090.ENSMUSP00000096595 UniGene: Mm.1433

Gene Functions References

High Npy2r expression is associated with chronic social defeat stress. PMID: 30201296
These results indicate that endogenous PYY has a hypoalgesic effect on somatic thermal and visceral chemical pain. The effect on visceral pain seems to be mediated by peripheral Y2 receptors. PMID: 28106168
NPY and agonists of Y2R and Y5R may be neuroprotective against oxygen-glucose deprivation-induced neuronal cell death in primary cortical cell cultures after delayed treatment. A Y2R agonist not only diminished transient cerebral ischemia-induced neuronal injury, but also improved functional outcome after delayed treatment. Y5 and especially Y2 receptors may be promising targets for neuroprotection against ischemic damage PMID: 28057538
Findings suggest that neuropeptide Y is expressed by distinct populations of neurons can modulate afferent and efferent projections of the central amygdala via presynaptic Y2 receptors located at inhibitory and excitatory synapses. PMID: 26365505
confirms the critical role of Y2 signalling to control neuropeptide Y and associated pro-opiomelanocortin expression in the arcuate nuclei PMID: 26444586
Study shows that NPY inhibits fear learning and promotes cued extinction by reducing fear expression also via activation of presynaptic Y2 receptors on central amygdala neurons PMID: 26314208
Our results showed the altered expression of NPY, Y1R and Y2R but not Y5R in hippocampus and temporal lobe cortex of tremor rat brain. PMID: 24444822
Data from knockout (KO) mice suggest roles for neuropeptide Y (NPY) and NPY2 receptors in fear acquisition/fear stimulus discrimination. Npy1r/Npy2r double KO mice display excessive recall of conditioned fear/impaired fear extinction. PMID: 22289084
NPY Y2 receptors control the level of hyperactive behavior under conditions of limited food access. PMID: 21923762
Peripheral Y2 receptor signaling is critical in the regulation of oxidative fuel selection and physical activity and protects against high-fat diet-induced obesity. PMID: 21546930
NPY-Y2 receptor exerts a direct control over both the tonic and phasic release of dopamine PMID: 21055451
Data describe the complex interaction between Y2/Y4 receptors in control of bone mass, and suggest that the reduction in cortical bone observed in the absence of leptin is due to the anti-osteogenic effect of elevated hypothalamic NPY levels. PMID: 20635164
Data from studies in knockout mice suggest that signaling through Y2 receptor prevents development of long-term anxiety-/depression-like behaviour caused by acute immune challenge. Study includes comparison with Y4 receptor knockout mice. PMID: 19939871
Taken together, this work demonstrates the critical roles of Y2 and Y4 receptors in the regulation of body composition and energy metabolism, highlighting dual antagonism of Y2 and Y4 receptors as a potentially effective anti-obesity treatment. PMID: 20881101
PYY/PYY(3-36) potently inhibits basal and stress/serotonin/cholinergic-stimulated propulsive colonic motor function in conscious mice, likely via Y(2) receptors PMID: 19892938
data reveal an anti-osteogenic effect of Y2 receptors on hypothalamic NPY-expressing neurons on trabecular but not on cortical bone PMID: 20613867
In Y2 knockout mice motor activity in the antrum was more affected than that in the duodenum, and both fed and fasted motor activities were affected in the antrum. PMID: 20501433
Results indicate that NPY Y2 receptor agonists inhibit diarrhea in mice by not only reducing intestinal fluid secretion, but also slowing colonic transit. PMID: 19925840
results are evidence of the highly site-specific nature of the Y2-mediated function of NPY in the modulation of anxiety- and depression-related behavior. PMID: 20445054
Y2 depletion influences a range of behaviours, which are potentially relevant for schizophrenia-related research PMID: 19879900
These findings attest to a differential role of Y2 and Y4 receptor signalling in the circadian control of behaviours that balance energy intake and energy expenditure. PMID: 19781771
Role of neuropeptide Y Y(2) receptors in modulation of cardiac parasympathetic neurotransmission PMID: 11786149
hypothalamic Y2 receptors are involved in a tonic inhibition of bone formation. PMID: 11927618
role in body weight regulation PMID: 12072562
Y2 receptor participates in cholesterol and glucose homeostasis of obese mice PMID: 12126735
PYY(3-36) inhibits food intake in mice but not in Y2r-null mice, which suggests that the anorectic effect requires the Y2R PMID: 12167864
Deletion of this receptor results in blockage of NPY-induced angiogenesis and delayed wound healing. PMID: 12730369
NPY Y(2) receptors may play an inhibitory role and supports the hypothesis that Y(2) receptors are involved in the regulation of anxiety-like behaviours by NPY PMID: 12742262
tonic activation of submucosal Y(2) receptors could indirectly reduce mucosal ion transport in the colon, while direct activation of Y(2) receptors on longitudinal muscle results in contraction PMID: 12813010
deletion of the Y2 receptor has revealed an important role of Y2 receptors in the generation of anxiety-related and stress-related behaviours in mice PMID: 12859347
Y2 and Y4 receptors have roles in adiposity and bone mass PMID: 12861009
High levels of NPY-Y2R expression in the preoptic nuclei suggest involvement of Y2R in the regulation of reproductive behavior, whereas Y2R expression in arcuate, dorsomedial, and perifornical nuclei may be relevant to feeding and body weight control. PMID: 14755515
NPY Y2-/- mice displayed a deficit on the probe trial in the Morris water maze task, and exhibited marked deterioration in object memory 6 h, but not 1 h, following initial exposure in the object recognition test PMID: 14997009
Results provide strong evidence for the role of the Y2 receptor mediating neuropeptide Y subjective day phase-advance shifts in mice. PMID: 15619538
Taken together, these data suggest that, in mice, both Y2 and Y5 receptors regulate hippocampal seizures in vitro, while activation of Y5 receptors in extra-hippocampal regions reduces generalized seizures in vivo. PMID: 15979311
These results demonstrate that the NPY Y2R is associated mainly with both peptidergic and nonpeptidergic small, presumably nociceptive, neurons projecting to the superficial layers of the dorsal horn. PMID: 16025447
A role is indicated for NPY-Y2 receptors in the accumulation of adipose tissue in the hypogonadal state; hypothalamic Y2 receptors constitutively restrain osteoblastic activity even in the absence of sex hormones. PMID: 16785231
The Y2-mediated anabolic pathway stimulates cortical and cancellous bone formation. PMID: 16995815
The widespread distribution of Y2R-positive cell bodies and fibers suggests that NPY signaling through the Y2R is common in the mouse brain. PMID: 16998904
Release of NPY tonically inhibits synaptic transmission in mice and its effects are mediated by Y2 receptor activation. However, both NPY and BIIE0246 were much less effective in mice than in rats. PMID: 17027162
fasting inhibits the somatotropic axis via direct action on Y2 receptors in the Arcuate nucleus and indirectly inhibits the gonadotropic axis via Y4 receptors. PMID: 17272395
Diet-induced obese mice had low plasma PYY, which may have caused compensatory up-regulation of PYY and Y2 receptor densities in medulla. PMID: 17615145
activation of neurons in the nucleus of the solitary tract following administration of T2R agonists to the GI tract involves CCK(1) and Y(2) receptors located on vagal afferent terminals in the gut wall PMID: 18003792
Data show that the replacement of a high-fat diet with a low-fat diet was associated with a significant lowering of ventromedial hypothalamic neuropeptide Y Y2 receptor binding, and also a lowered plasma PYY level. PMID: 18357520
Mice lacking Y2 receptors exhibited reduced neuronal activation when compared to WT animals in response to the emotional stressors. PMID: 19084906
critical role for neuropeptide Y/neuropeptide Y2 receptor interactions in adipogenesis PMID: 19182605

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.