Recombinant Mouse Neural Retina-Specific Leucine Zipper Protein (NRL) Protein (His-SUMO&Myc)

Name: Recombinant Mouse Neural Retina-Specific Leucine Zipper Protein (NRL) Protein (His-SUMO&Myc)
Brand: Beta LifeScience
SKU: BLC-03981P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Neural Retina-Specific Leucine Zipper Protein (NRL) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P54846
Target Symbol	NRL
Synonyms	Nrl; Neural retina-specific leucine zipper protein; NRL
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His-SUMO&C-Myc
Target Protein Sequence	MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL
Expression Range	1-237aa
Protein Length	Full Length
Mol. Weight	46.1 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.
Subcellular Location	Cytoplasm. Nucleus.
Protein Families	BZIP family
Database References	KEGG: mmu:18185 STRING: 10090.ENSMUSP00000054457 UniGene: PMID: 29533784 Following Nrl disruption, rods gain partial features of cones and present with improved survival in the presence of mutations in rod-specific genes, consequently preventing secondary cone degeneration. In three different mouse models of retinal degeneration, the treatment substantially improves rod survival and preserves cone function. PMID: 28291770 Nrl is posttranscriptionally regulated to facilitate the generation of other cell types in retina PMID: 27878762 De novo assembly and alternative splicing analyses revealed previously unannotated rod-enriched transcripts and the role of NRL in transcript maturation. PMID: 27880916 Our studies reveal coregulation of coding and noncoding transcripts in rod photoreceptors by NRL and establish the framework for deciphering the function of ncRNAs during retinal development. PMID: 28863214 To explore dendritic stratification of OFF bipolar cells in the absence of rods, we made use of the 'cone-full' Nrl-/- mouse retina in which all photoreceptor precursor cells commit to a cone fate including those which would have become rods in wild-type retinas PMID: 28257490 CNGA3 expression restored cone function in in CNGA3-/-/Nrl-/- mice, an all-cone model of CNGA3 achromatopsia. PMID: 25855802 REEP6.1 is a key functional target of NRL-centered transcriptional regulatory network in rod photoreceptors. PMID: 24691551 Data indicate that positive feedback between neural retina leucine zipper factor (NRL) and retinoid-related orphan receptor beta gene (Rorb) genes reinforces the commitment to a rod differentiation fate. PMID: 25296752 shRNA-mediated knockdown of Crx and Nrl resulted in reduced Kcnv2 promoter activity and low endogenous Kcnv2 mRNA expression in the retina. PMID: 24664678 This study analyzed the retinal pigment epithelium from Nrl(-/-) mice of various ages for lipofuscin fluorescence and A2E levels. PMID: 22417141 Findings suggest that elimination of Nrl in adult rods may represent a unique therapy for retinal degeneration. PMID: 23319618 Our results show that NRL and CRX together control the expression of most, if not all, genes involved in rod phototransduction through a cis-regulatory module PMID: 22511886 found that Nrl activated rhodopsin and Ppp2r5c transcription by recruiting Tip60 to promote histone H3/H4 acetylation PMID: 22354990 Nrl as a direct transcriptional target of RORbeta and suggest that combinatorial action of multiple regulatory factors modulates the expression of Nrl in developing and mature retina. PMID: 21673114 Nrl-deficient retina may serve as a model for elucidating mechanisms of cone homeostasis and degeneration that would be relevant to understanding diseases of the cone-dominant human macula. PMID: 22238088 a model in which Nrl expression is primarily initiated by OTX2 and RORbeta and later maintained at high levels by CRX and RORbeta. PMID: 21865162 Cone-like outer segment phagocytosis in Nrl(-/-) mice shows a similar profile to that of rods in normal mice and other species. PMID: 21203345 results suggest that Ppp2r5c expression is regulated by Nrl during retinogenesis through direct binding to the promoter region of Ppp2r5c PMID: 21078119 Studies suggest an important role of sumoylation in fine-tuning the activity of NRL and thereby incorporating yet another layer of control in gene regulatory networks involved in photoreceptor development and homeostasis. PMID: 20551322 the function of NRL is modulated by its interaction with specific repressor proteins, related to cross-talk between signaling pathways in the retina PMID: 12566383 both Nrl and Crx are required for full transcriptional activity of the PDE6A gene PMID: 15001570 a 2.5-kb Nrl promoter segment directs the expression of enhanced GFP specifically to rod photoreceptors and the pineal gland PMID: 16505381 NRL is not only essential but is sufficient for rod differentiation PMID: 17242361 Nrl and Grk1 have roles in photoresponse recovery and age-related degeneration PMID: 17249566 Rorbeta directs rod development and does so in part by inducing the Nrl-mediated pathway of rod differentiation. PMID: 19805139

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.