Recombinant Mouse Nad-Dependent Protein Deacylase Sirtuin-5, Mitochondrial (SIRT5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01364P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Nad-Dependent Protein Deacylase Sirtuin-5, Mitochondrial (SIRT5) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01364P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Nad-Dependent Protein Deacylase Sirtuin-5, Mitochondrial (SIRT5) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q8K2C6 |
| Target Symbol | SIRT5 |
| Synonyms | Regulatory protein SIR2 homolog 5 SIR2-like protein 5 |
| Species | Mus musculus (Mouse) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SSNMADFRKCFANAKHIAIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPQAFARNPSQVWEFYHYRREVMRSKEPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTSCGTVAENYRSPICPALAGKGAPEPETQDARIPVDKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELALCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNMETTPATDRFRFHFPGPCGKTLPEALAPHETERTS |
| Expression Range | 37-310aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 34 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting. Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species. Activates SHMT2 by mediating its desuccinylation. Modulates ketogenesis through the desuccinylation and activation of HMGCS2. Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as Uox. |
| Subcellular Location | Mitochondrion. Cytoplasm, cytosol. Nucleus. Note=Mainly mitochondrial. Also present extramitochondrially, with a fraction present in the cytosol and very small amounts also detected in the nucleus. |
| Protein Families | Sirtuin family, Class III subfamily |
| Database References | KEGG: mmu:68346 STRING: 10090.ENSMUSP00000071048 UniGene: PMID: 27435822 |
