Recombinant Mouse Nacht, Lrr And Pyd Domains-Containing Protein 3 (NLRP3) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04144P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Nacht, Lrr And Pyd Domains-Containing Protein 3 (NLRP3) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04144P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Nacht, Lrr And Pyd Domains-Containing Protein 3 (NLRP3) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb Q8R4B8
Target Symbol NLRP3
Synonyms Nlrp3; Cias1; Mmig1; Nalp3; Pypaf1; NACHT; LRR and PYD domains-containing protein 3; Cold autoinflammatory syndrome 1 protein homolog; Cryopyrin; Mast cell maturation-associated-inducible protein 1; PYRIN-containing APAF1-like protein 1
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR
Expression Range 1-153aa
Protein Length Partial
Mol. Weight 34.2kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function As the sensor component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. In response to pathogens and other damage-associated signals, initiates the formation of the inflammasome polymeric complex, made of NLRP3, PYCARD and CASP1 (or possibly CASP4/CASP11). Recruitment of proCASP1 to the inflammasome promotes its activation and CASP1-catalyzed IL1B and IL18 maturation and secretion in the extracellular milieu. Activation of NLRP3 inflammasome is also required for HMGB1 secretion. The active cytokines and HMGB1 stimulate inflammatory responses. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death. Under resting conditions, NLRP3 is autoinhibited. NLRP3 activation stimuli include extracellular ATP, reactive oxygen species, K(+) efflux, crystals of monosodium urate or cholesterol, amyloid-beta fibers, environmental or industrial particles and nanoparticles, cytosolic dsRNA, etc. However, it is unclear what constitutes the direct NLRP3 activator. Activation in presence of cytosolic dsRNA is mediated by DHX33. Independently of inflammasome activation, regulates the differentiation of T helper 2 (Th2) cells and has a role in Th2 cell-dependent asthma and tumor growth. During Th2 differentiation, required for optimal IRF4 binding to IL4 promoter and for IRF4-dependent IL4 transcription. Binds to the consensus DNA sequence 5'-GRRGGNRGAG-3'. May also participate in the transcription of IL5, IL13, GATA3, CCR3, CCR4 and MAF.
Subcellular Location Cytoplasm, cytosol. Inflammasome. Endoplasmic reticulum. Secreted. Nucleus.
Protein Families NLRP family
Database References

KEGG: mmu:216799

STRING: 10090.ENSMUSP00000078440

UniGene: PMID: 30060081

  • Inflammasome stimuli can act as polarizing cues to initiate dynamic NLRP3 and MARK4 transport in macrophages. PMID: 28656979
  • CD36 might play an important role in podocyte apoptosis by activating the NLRP3 inflammasome in primary nephrotic syndrome. PMID: 30258045
  • Data indicate function of macrophage migration inhibitory factor (MIF) as a regulator of the NLR family pyrin domain containing 3 (NLRP3) inflammasome complex in macrophages. PMID: 29884801
  • In agreement with a possible neutrophil contribution to systemic inflammation in cryopyrin associated periodic syndrome, the levels of neutrophil secretory proteins were significantly elevated in the plasma from Nlrp3(A350V) mice. PMID: 29322034
  • NLRP3(R258W)-induced remodelling of the gut microbiota, induces local Tregs to maintain homeostasis and compensate for otherwise-detrimental intestinal inflammation. PMID: 29196621
  • Pyrin signaling is dispensable for Clostridium difficile infection (CDI) associated intestinal epithelial cells death and for in vivo pathogenesis; C. difficile enterotoxins induce activation of executioner caspases 3/7 via the intrinsic apoptosis pathway indicating that caspase-3/7-mediated intestinal epithelial cells apoptosis is critical for in vivo host defense during early stages of CDI. PMID: 30451870
  • The results of this study suggested that the upregulation of NLRP3 in DRG via STAT3-dependent histone acetylation is critically involved in bortezomib-induced mechanical allodynia. PMID: 29339053
  • sumoylation of NLRP3 restrains inflammasome activation, and identify SUMO proteases as potential drug targets for the treatment of inflammatory diseases. PMID: 30069026
  • Nephrocalcinosis-related chronic kidney disease involves NLRP3 but not necessarily via intrarenal IL-1 release but rather via other biological functions including TGFR signaling and macrophage polarization. PMID: 29241624
  • Study shows that the NLRP3 inflammasome was involved in the complex diseases of diabetic stroke. MCC950, the NLRP3 specific inhibitor, ameliorated diabetic mice with cerebral ischemia-reperfusion injury and improved the 28-day survival rate during the recovery stage of ischemic stroke. PMID: 29853850
  • NLRP3 inflammasome serves as a key player in the pathogenesis of IgA nephropathy (IgAN) partly through activation of T cells and mitochondrial ROS production and that a local, kidney-targeting suppression of NLRP3 be a therapeutic strategy for IgAN. PMID: 28117341
  • Study in mice models shows that perforin from antigen-specific cytotoxic T lymphocytes is required for Nlrp3 inflammasome activation in antigen-presenting cells. Furthermore, such activation of NLRP3 inflammasome contributes to the induction of antigen-specific antitumour immunity and pathogenesis of graft-versus-host diseases. PMID: 28537251
  • The results show that the NLRP3 inflammasome impairs host defense during lethal pneumonia caused by serotype 3 Streptococcus pneumoniae . PMID: 28971472
  • this study shows that soluble uric acid activates the NLRP3 inflammasome PMID: 28084303
  • These findings indicate that the NAD(+)/SIRT2 pathway is an important mediator through which silybin prevents NLRP3 inflammasome activation during NAFLD PMID: 28970254
  • NEK7 is a specific K(+) sensor and does not associate with NLRP3 under conditions stimulating exclusively Cl(-) efflux, but does after K(+) efflux, activating the complex driving inflammation. PMID: 30232264
  • miR155 expression levels were significantly increased in an in vivo model of psoriasis compared with normal tissues, as was the expression of NLR family pyrin domain containing 3 (NLRP3). PMID: 29767259
  • Anaplastic lymphoma kinase (ALK) is a novel regulator of NLRP3 inflammasome activation in macrophages. Mechanically, ALK-mediated NF-kappaB activation was required for the priming step of NLRP3 upregulation, whereas ALK-mediated lipid peroxidation contributed to the sensing step of NLRP3-NEK7 complex formation. PMID: 29723525
  • The role of NLGN3 in regulating depression in mice was confirmed in vitro using astrocytes stimulated by lipopolysaccharide (LPS) that NLGN3 knockdown reduced LPS-induced inflammation. PMID: 29775613
  • we found that butyrate significantly decreased Nlrp3 inflammasome formation and activation in the carotid arterial wall of wild type mice (Asc(+/+)), which was comparable to the effect of gene deletion of the adaptor protein apoptosis-associated speck-like protein gene (Asc(-/-)). PMID: 29475132
  • These results suggest that mitochondrial ROS-TXNIP/NLRP3/IL-1beta axis activation is responsible for tubular oxidative injury, which can be ameliorated by MitoQ via the inhibition of mtROS overproduction PMID: 29475133
  • Studied the anti-inflammatory effects of corylin on attenuation of lipopolysaccharide (LPS)-induced inflammation and inhibition of activation of nucleotide-binding oligomerization domain-like receptor containing pyrin domain 3 (NLRP3) inflammasome in LPS-activated BV2 cells. PMID: 30107806
  • Data suggest that Abl2 on chromosome 1 and Nlrp3 on chromosome 11 are key to spermatozoa function; here, genetic polymorphisms in Abl2 and Nlrp3 appear to regulate susceptibility of mouse spermatozoa to cryopreservation. (Abl2 = v-abl Abelson murine leukemia viral oncogene 2; Nlrp3 = NLR family pyrin domain containing protein-3) PMID: 29269609
  • This study demonstrated that Hcy activates adipose NLRP3 inflammasomes in an adipocyte lyso-PC-dependent manner and highlights the importance of the adipocyte NLRP3 inflammasome in insulin resistance. PMID: 29735414
  • TLR2 and NLRP3 inflammasome activation in cardiac macrophages mediate the production of IL-1beta in diabetic mice. IL-1beta causes prolongation of the action potential duration, induces a decrease in potassium current and an increase in calcium sparks in cardiomyocytes, which are changes that underlie arrhythmia propensity. PMID: 27882934
  • TRIM31, through its E3 ubiquitin ligase activity, mediated K48-linked ubiqutination and proteasomal degradation of NLRP3. PMID: 27929086
  • fenofibrate attenuates oxidative stress and neuroinflammation in diabetic retinas, which is at least partially through modulating Nrf2 expression and NLRP3 inflammasome activation PMID: 29264825
  • NLRP3 inflammasome is inhibited by NSAIDs in mouse and rat models of Alzheimer's disease PMID: 27509875
  • These findings indicate that the NALP3 inflammasome is involved in H2O2induced type I collagen synthesis, which is mediated by the NFkappaB signaling pathway. Additionally, the NALP3 inflammasome contributes to the development of bleomycininduced pulmonary fibrosis. PMID: 29393339
  • 25-hydroxycholesterol contributes to cerebral inflammation of X-linked adrenoleukodystrophy through activation of the NLRP3 inflammasome. PMID: 27779191
  • Data suggest that gut microbiota present significantly altered growth patterns (that is, dysbiosis) in diabetic mice; these changes are attenuated in diabetic knockout mice lacking Nlrp3, an important component of inflammasomes and innate immunity. PMID: 29435463
  • Double-stranded RNA from M. tuberculosis induces NLRP3-dependent caspase-1 activation in retinal pigment epithelium. PMID: 29180292
  • NALP3 signaling is required for the induction of inflammatory response and the development of liver regeneration after PHx PMID: 28656530
  • this study reveals a novel differential role for NLRP3 inflammasome pathway in the immunity against clinically relevant Acinetobacter baumannii infections PMID: 28612844
  • Inhibition of NLRP3 inflammasome activation may be a potential therapeutic approach to alleviate MS-associated CNP and disease relapses in patients with RR-MS. PMID: 28965161
  • TREM-1 aggravates inflammation in acute lung injury by activating NLRP3 inflammasome, and blocking TREM-1 may be a potential therapeutic approach for acute lung injury PMID: 28004759
  • Findings indicate a selective vulnerability of sensory thalamic neurons in amyotrophic lateral sclerosis model mice, which is accompanied by massive dendrite swelling, accumulation of misfolded human SOD1, impaired autophagy and neuronal loss. Furthermore, ineffective autophagy and increased NLRP3 inflammasome expression in damaged neurons may be responsible for cell death and further spreading of the disease. PMID: 27880990
  • Data show that Pr2x7 gene deletion protects from HFD-induced NASH, possibly through blunted activation of NLRP3 inflammasome. PMID: 29270247
  • Results reveal a possible mechanism for AGE-induced pancreatic islet damage upon NLRP3 inflammasome activation. PMID: 29230270
  • Study demonstrated that activating alpha7nAChR contributed to the inhibition of NLRP3 inflammasome activation through the beta-arrestin-1-mediated manner in experimental auto-immune encephalomyelitis. PMID: 28941191
  • Results suggest a novel signaling pathway through which CB2 receptors are involved in the analgesic effect of electroacupuncture (EA) on inflammatory pain. These results suggest that EA reduces the inflammatory pain by inhibiting the activation of NLRP3 inflammasome through CB2 receptors. PMID: 28782714
  • miR-223 deficiency can lead to the sustained activation of NLRP3-IL-1beta. PMID: 29144508
  • NLRP3 plays a pivotal role in NASH development and pro-inflammatory cytokines IL-1beta and IL-18 secretion induced by PA stimulatio PMID: 28730512
  • Activation of Nlrp3 inflammasome may contribute to MPTP-induced neuroinflammation in SNpc, whereas miR-30e inhibits this process by targeting Nlrp3. PMID: 29274035
  • This study indicated that the NLRP3 inflammasome is significantly implicated in the progression of systemic inflammation-induced depression PMID: 29016824
  • findings provide compelling evidence of a role for Nlrp3 in nigral degeneration and neuroinflammation resulting from systemic rotenone exposure and suggest that the suppression of NLRP3 activity may be a rational neuroprotective strategy for toxin-associated PD PMID: 28903492
  • indicate the role of P2X7R (purinergic 2X7 receptor) and NLRP3 (NACHT, LRR, and PYD domains-containing protein 3) inflammasome activation in the process of pancreatic fibrosis in chronic pancreatitis (CP) and suggest that blockade of P2X7R-NLRP3 inflammasome signaling pathway may represent a therapeutic strategy for CP and its fibrotic process. PMID: 28930866
  • TLR4 and NLRP3 are suppressed by alpinectin, which attenuates inflammation in DSS-induced acute colitis PMID: 27321991
  • High expression of NLRP3 is associated with radiculopathy. PMID: 28404518
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed