Recombinant Mouse Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His)

Name: Recombinant Mouse Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07226P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Myelin-Oligodendrocyte Glycoprotein (MOG) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q61885
Target Symbol	MOG
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT
Expression Range	29-156aa
Protein Length	Partial
Mol. Weight	20.6 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. Mediates homophilic cell-cell adhesion.
Subcellular Location	Membrane; Multi-pass membrane protein.
Protein Families	Immunoglobulin superfamily, BTN/MOG family
Database References	KEGG: mmu:17441 STRING: 10090.ENSMUSP00000099726 UniGene: Mm.210857
Tissue Specificity	Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes. Reduced expression levels are observed in jimpy and quacking dysmyelinating mutant mice.

Gene Functions References

The aim of this work was to explore the conformational characteristics of rat/mouse MOG35-55 immunodominant epitope. The results are discussed in terms of rational design of altered peptide ligands or non-peptide mimetics based on rat MOG35-55 that could be served as potential inhibitors of experimental autoimmune encephalomyelitis PMID: 27483998
Identify nerve growth factor as a binding partner for MOG and demonstrate that this interaction is capable of sequestering NGF from TrkA-expressing neurons to modulate axon growth and survival. PMID: 26347141
the absence of N-glycan did not interfere with MOG's subcellular localization and it did not result in activation of endoplasmic reticulum stress. PMID: 25541284
Data indicate that in mixed chimeras with bone marrow-encoding myelin oligodendrocyte glycoprotein (MOG), the development of MOG-specific B cells was abrogated, resulting in a lack of MOG-specific B cells in all B cell compartments examined. PMID: 24532581
Different forms of evolution of optic neuritis are observed in this animal model suggest that variations of biosynthetic MOG35-55 peptide concentration are capable of inducing different profiles of optic neuritis. PMID: 24083391
Identify immunogenic/encephalitogenic T-cell epitopes within MOG capable of inducing experimental autoimmune encephalomyelitis in C57BL/6 mice. PMID: 23876060
PLP significantly suppresses both models of experimental autoimmune encephalitis (EAE)even when there is some evidence of epitope spreading in the myelin oligodendrocyte (MOG)38-50-induced EAE model. PMID: 23911075
CNTF may play a role in the process of remyelination by inducing the MOG expression. PMID: 23443463
MOG-specific CD4-positive T cells accumulate within the chemokine-expressing draining lymph nodes, rather than within the brain or spinal cord during induction of autoimmune encephalomyelitis. PMID: 22287719
This study provides valuable information about requirements of anti-myelin oligodendrocyte glycoprotein reactivity for being regarded as a prognostic biomarker in a subtype of MS. PMID: 22093619
Mice immunized with encephalitogenic myelin oligodendrocyte glycoprotein MOG(35-55) peptide develop significant serum levels of anti-MOG antibodies in parallel with disease progression. PMID: 21993076
B cell-deficient mice exhibit reduced medullary thymic epithelial cell numbers and reduced MOG mRNA expression. PMID: 21550671
Cell surface targeting of MOG is not disrupted in the absence of the endoplasmic reticulum chaperones. PMID: 21172390
MOG self-tolerance modulates the encephalitogenic potential of autoreactive MOG T cells in the periphery. PMID: 14624757
The core epitope of immunodominant 35-55 peptide (pMOG) fragment has the potential to be citrullinated at two T cell receptor contact residues 41-Arg and 46-Arg, allowing an expanded repertoire of T cells to contribute to encephalomyelitis etiopathology. PMID: 20164413
lack of systemic complement at the time of induction of EAE delays the onset and attenuates the course of the disease most probably via diminishing the response of MOG-specific T cells and production of autoantibodies PMID: 19201476
The encephalitogenic peptide of intact MOG protein (resides 35-55) must be processed and presented via a functioning class II-restricted antigen processing pathway in the central nervous system in order to initiate autoimmune demyelinating disease. PMID: 11937578
role in development of spontaneous autoimmune optic neuritis PMID: 12732654
MOG has a role in immune tolerance and in experimental autoimmune encephalomyelitis PMID: 12925695
Treatment of oligodendrocytes with anti-MOG leads to an increase in calcium influx and activation of the MAPK/Akt pathways. PMID: 15634682
Opticospinal encephalomyelitis mice B cells bind high dilutions of recombinant MOG, but not MOG peptide, and process and present it to autologous T cells. PMID: 16955140
Ig heavy chainMOG mice spontaneously develop a severe form of experimental autoimmune encephalomyelitis. PMID: 16955141
prevention of experimental autoimmune encephalomyelitis by treatment with embryonic stem cell-derived dendritic cells(ES-DC)-TRAIL/MOG is mediated by MOG-reactive CD4(+)CD25(+) Treg propagated by ES-DC-TRAIL/MOG PMID: 17202353
Results describe T cell receptor (TCR) transgenic mice (relapsing-remitting [RR] mice) carrying a TCR specific for myelin oligodendrocyte glycoprotein (MOG) peptide 92-106. PMID: 19487416
CD8+ T cells reactive to MOG37-46 are pro-inflammatory and traffic to the CNS; however, the presence of CD4+ T cells elicits more severe disease and sustained inflammation of the CNS. PMID: 19540601
the ligation of CEACAM1 negatively regulates the severity of experimental autoimmune encephalomyelitis by reducing MOG(35-55)-specific induction of both interferon-gamma and interleukin-17 via invariant natural killer T cell-dependent mechanisms PMID: 19700760
protein localization signal PMID: 11389181

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.