Recombinant Mouse Myelin Basic Protein (MBP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00419P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Myelin Basic Protein (MBP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00419P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Myelin Basic Protein (MBP) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P04370 |
| Target Symbol | MBP |
| Species | Mus musculus (Mouse) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR |
| Expression Range | 1-250aa |
| Protein Length | Full Length |
| Mol. Weight | 29.2 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The classic group of MBP isoforms (isoform 4-isoform 13) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined to optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. |
| Subcellular Location | [Isoform 13]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 12]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 11]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 10]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 9]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 8]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 7]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 6]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 5]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 4]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 3]: Cytoplasm. Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.; [Isoform 1]: Cytoplasm. Nucleus. |
| Protein Families | Myelin basic protein family |
| Database References | KEGG: mmu:17196 STRING: 10090.ENSMUSP00000046185 UniGene: PMID: 29111742 |
