Recombinant Mouse Mucin-4 (MUC4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00454P

Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Mucin-4 (MUC4) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00454P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Mucin-4 (MUC4) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q8JZM8 |
Target Symbol | MUC4 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | WNDKPSFCVWYQLRRPRVSCAGYRPPRPAWTFGDPHITTLDNANFTFNGLGDFLLVQAQDRNSSFLLEGRTAQTGTAKATNFIAFAAQYNTSSLKSPITVQWFLEPSDKIRVVYNNQTVAFNTRDTEVLPIFNTTGVLLTQNGSQVSANFDGTVTISVIARSNILHASSSLSEEYRNHTEGLLGVWNDNPEDDFRMPNGSTIPSNSSEETLFYYGMTWHVNGTGLLGIRADPLPT |
Expression Range | 2712-2946aa |
Protein Length | Partial |
Mol. Weight | 33.6 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Membrane-bound mucin, a family of highly glycosylated proteins that constitute the major component of the mucus, the slimy and viscous secretion covering epithelial surfaces. These glycoproteins play important roles in the protection of the epithelium and are implicated in epithelial renewal and differentiation. Regulates cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and its ability to act as an intramembrane ligand for ERBB2. Plays an important role in proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. In polarized epithelial cells, segregates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. Its ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation. |
Subcellular Location | [Mucin-4 beta chain]: Cell membrane; Single-pass membrane protein.; [Mucin-4 alpha chain]: Cell membrane. Secreted. |
Database References | UniGene: Mm.214599 |
Tissue Specificity | Expressed in trachea, duodenum and intestine. Lower expression in stomach, salivary glands, liver, gallbladder, and kidney. |