Recombinant Mouse Metallothionein-3 (MT3) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-07817P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Mouse Metallothionein-3 (MT3) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-07817P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Metallothionein-3 (MT3) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P28184
Target Symbol MT3
Synonyms Growth inhibitory factor Short name: GIF
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEAEKCSCCQ
Expression Range 1-68aa
Protein Length Full Length
Mol. Weight 14.5 kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.
Protein Families Metallothionein superfamily, Type 1 family
Database References

KEGG: mmu:17751

STRING: 10090.ENSMUSP00000034211

UniGene: PMID: 26637294

  • Circadian time and lighting could be involved in the regulation of the expression of melatonin receptors MTNR3 and Rorc. PMID: 25189895
  • Mt3 may act through PDE3a to play a key role in Zinc dyshomeostasis and cell death in streptozotocin-treated islets. PMID: 25054451
  • Zn released from MT3 may contribute to VEGF induction. PMID: 23962989
  • The entire MT3 peptide shows a high capacity to bind Cu(+) , provided that this occurs in a nonoxidative milieux. This reflects a peculiar property of this MT isoform, which senses different Cu contents in the environment in which it is synthesized. PMID: 24479872
  • MT-III can help protect against light-induced retinal damage compared to MT-I/II. Some of these effects may be exerted by its antioxidative potency. PMID: 23132798
  • MT-3 is able to alter the Tg2576 phenotype in several aspects such as mortality and behavior in a gender-dependent manner. PMID: 22722772
  • ZnMt3 in cultured astrocytes may be a normal component of c-Abl activation in EGF receptor signaling PMID: 21900236
  • Metallothionein-III null mice show attenuation of cadmium-induced severe testicular toxicity, suggesting that lack of MT-III contributes to protection of testis from cadmium. PMID: 20851133
  • results indicate that MT3 may play a key role in normal lysosomal function in cultured astrocytes PMID: 20544854
  • findings indicate that abnormalities of psychological behavior were observed in the MT-3 knock-out mice PMID: 19799968
  • engineered protein has neuroinhibitory activity when introduced into metallothionein-1 PMID: 12130647
  • a correct MTs homeostasis is pivotal for brain-endocrine-immune response in order to reach successful ageing. PMID: 12714242
  • Metallothionein 3 [Mt3]-null mice had increased expression of neurotrophins as well as GAP-43 following cryoinjury. Thus MT-III does not affect the inflammatory response, but it may influence neuronal regeneration during recovery PMID: 12758064
  • MT-III isoform, which has a limited tissue distribution, especially in the central nervous system, seems to be implicated in tissue repair and/or protection against critical tissue injury PMID: 17435258
  • These findings indicate that neuronal damage was aggravated by reperfusion injury in the MT-III KO mice compared with the wild-type mice, suggesting that MT-III plays anti-oxidative and neuroprotective roles in transient cerebral ischemia. PMID: 19635467
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed