Recombinant Mouse Merlin (NF2) Protein (His-Trx)

Name: Recombinant Mouse Merlin (NF2) Protein (His-Trx)
Brand: Beta LifeScience
SKU: BLC-05175P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Merlin (NF2) Protein (His-Trx) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P46662
Target Symbol	NF2
Synonyms	Nf2; Nf-2Merlin; Moesin-ezrin-radixin-like protein; Neurofibromin-2; Schwannomin
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-Trx
Target Protein Sequence	MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQ
Expression Range	1-320aa
Protein Length	Partial
Mol. Weight	55.9 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Probable regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in tumor suppression by restricting proliferation and promoting apoptosis. Along with WWC1 can synergistically induce the phosphorylation of LATS1 and LATS2 and can probably function in the regulation of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway. May act as a membrane stabilizing protein. May inhibit PI3 kinase by binding to AGAP2 and impairing its stimulating activity. Suppresses cell proliferation and tumorigenesis by inhibiting the CUL4A-RBX1-DDB1-VprBP/DCAF1 E3 ubiquitin-protein ligase complex. Plays a role in lens development and is required for complete fiber cell terminal differentiation, maintenance of cell polarity and separation of the lens vesicle from the corneal epithelium.
Subcellular Location	Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection. Cytoplasm, cytoskeleton. Nucleus.
Database References	KEGG: mmu:18016 STRING: 10090.ENSMUSP00000105536 UniGene: PMID: 29408605 Data indicate an essential role for NF2 and the Hippo pathway in regulation of branching morphogenesis in the mammalian kidney. PMID: 27480037 Loss of Nf2 causes hyperplasia and ocular abnormalities. PMID: 29249622 studies suggest that NF2 normally limits biliary morphogenesis by coordinating lumen expansion and cell architecture. This work provides fundamental insight into how biliary fate and tubulogenesis are coordinated during development and will guide analyses of disease-associated and experimentally induced biliary pathologies. PMID: 29712669 Data show that early Smarcb1 loss causes rhabdoid tumors whereas loss at later stages combined with Nf2 gene inactivation causes shwannomas. PMID: 28824165 Rho attenuates the interaction between Amot and Nf2 by binding to the coiled-coil domain of Amot. PMID: 28947533 co-deletion of Rac1 with Nf2 blocks tumor initiation but paradoxically exacerbates hepatomegaly induced by Nf2 loss, which can be suppressed either by treatment with pro-oxidants or by co-deletion of Yap. PMID: 27818180 Merlin controls the repair capacity of Schwann cells after injury by regulating Hippo/YAP signaling activity. PMID: 28137778 NF2 is activated by oxidative stress in cardiomyocytes and myocardium and facilitates apoptosis. PMID: 27402866 loss of axonal contact following nerve injury results in merlin phosphorylation leading to increased p75(NTR) expression. PMID: 26057084 Loss of Nf2 and Cdkn2a/b have synergistic effects with PDGF-B overexpression promoting meningioma malignant transformation. PMID: 26418719 Merlin 1 and 2 act as tumor suppressors and are required for optimal sperm maturation PMID: 26258444 Together our results uncover miRNAs as yet another negative mechanism controlling Merlin tumor suppressor functions. PMID: 26549232 Merlin and Ezrin are components of a mechanism where mechanical forces associated with cell junctions are transduced across the cell cortex via cortical actomyosin cytoskeleton to control lateral mobility and activity of epidermal growth factor receptor. PMID: 26483553 The study describe a novel NF2 mouse model recapitulating schwannoma phenotypes found in human patients where tumors develop in the cranial nerve VIII and/or the spinal roots. PMID: 25113746 Nf2/Merlin controls spinal cord neural progenitor function in a Rac1/ErbB2-dependent manner. PMID: 24817309 Nf2-Yap signaling plays important roles in controlling the expansion of dorsal root ganglia progenitors and glia during DRG development PMID: 25433207 CD44 cytoplasmic tail cleaved by RIP could release DCAF1 from merlin by competing for binding to the merlin FERM domain, which results in the inhibition of merlin-mediated suppression of tumorigenesis. PMID: 24912773 Findings indicate that merlin is sumoylated and that this post-translational modification is essential for tumor suppression. PMID: 24166499 Cdc42 regulates SC radial sorting in vivo through Neurofibromin 2/merlin dependent signaling pathways PMID: 24014231 The data establish a clear role for Nf2 upstream of Yap in the preimplantation embryo and demonstrate that Hippo signaling is essential to segregate the inner cell mass from the trophectoderm. PMID: 23791728 These results indicate that in both Drosophila and mammals, Merlin activates Wts/Lats phosphorylation without stimulating the intrinsic kinase activity of Hpo/Mst. PMID: 24012335 Meningioma progression in mice triggered by Nf2 and Cdkn2ab inactivation. PMID: 23045274 Signaling between Nf2 and Rac1 occurs in a bidirectional fashion, and these interactions are modulated by PKA. PMID: 23045281 Nf2 is required for hippocampal morphogenesis. Yap/Taz are key downstream effectors of Nf2 during brain development. PMID: 23863479 Neurofibromin 2 is an AKAP (A-kinase-anchoring protein) scaffold protein that facilitates the function of the cAMP/PKA-LATS-YAP pathway. PMID: 23644383 propose that Merlin mediates contact inhibition and suppresses tumorigenesis by translocating to the nucleus to inhibit CRL4(DCAF1). PMID: 21878678 Results demonstrate that Schwannomin plays an essential role in inducing and/or maintaining the SC's spindle shape, and by stabilizing the bipolar morphology, Sch promotes the alignment of SCs with axons and ultimately influences myelin segment length. PMID: 21182951 FERM domain-mediated phosphoinositide binding and membrane association are critical for the growth-regulatory function of merlin PMID: 21402777 Depletion of Angiomotin in Nf2(-/-) Schwann cells attenuates the Ras-MAPK signaling pathway, impedes cellular proliferation in vitro and tumorigenesis in vivo PMID: 21481793 Neurofibromatosis type 2 protein is inactivated in glioblastoma cells by overexpression of ezrin. PMID: 20156804 Results reveal that Merlin can associate directly with alpha-catenin and link it to Par3, thereby providing an essential link between the AJ and the Par3 polarity complex during junctional maturation. PMID: 21074722 a critical role for Nf2/Merlin in controlling homeostasis of the liver stem cell niche PMID: 20675406 Nf2-deficient phenotypes in multiple tissues were largely suppressed by heterozygous deletion of Yap, suggesting that YAP is a major effector of Merlin/NF2 in growth regulation. PMID: 20643348 This study provided merlin plays a pivotal role in controlling the neuronal wiring in the developing CNS. PMID: 20668201 Tumor suppression by merlin is independent of its role as an organizer of the actin cytoskeleton in Schwann cells. PMID: 19910496 Rac1-mediated canonical Wnt signaling is essential for the loss of contact inhibition in NF2-deficient cells. PMID: 20154721 Structural basis for neurofibromatosis type 2 PMID: 11756419 phosphorylation of merlin at serine 518 leads to dramatic protein relocalization PMID: 11782491 Nf2 and p53 mutations do not synergize in meningeal tumorigenesis.Nf2 gene inactivation in arachnoidal cells is rate-limiting for meningioma development in the mouse. PMID: 12000789 Mutant products of the NF2 tumor suppressor gene are degraded by the ubiquitin-proteasome pathway PMID: 12130630 A FERM domain mutant of the Nf2 tumor suppressor gene causes cellular transformation and tumorigenesis in mice PMID: 12203111 Merlin inhibits Pak1;loss of Merlin leads to inappropriate activation of Pak1. Conversely, the overexpression of Merlin leads to inhibition of Pak1 activation. PMID: 14580336 biallelic loss of Nf2 function in neural crest-derived cells hemizygous for p53 results in resistance to osteogenic tumours and increased susceptibility to peripheral nerve sheath tumours PMID: 15221010 erbin regulates MAP kinase activation in Schwann cells and suggest that erbin links merlin to both adherens junction protein complexes and the MAP kinase signaling pathway. PMID: 15659388 NF2 tumor suppressor Merlin and the ERM proteins interact with N-WASP and regulate its actin polymerization function PMID: 15699051 In brain tissue and neuronal progenitor cell cultures merlin was predominantly found in neurons. Merlin expression was seen from Day 11 in mouse embryos. PMID: 15797715 These results suggest that merlin contributes, via its protein-to-protein interaction with Grb2 and consequent inhibition of the MAPK pathways. PMID: 16405865 PP1-delta and MYPT-1 were co-precipitated with endogenous merlin from NIH-3T3 cells PMID: 16885985 inhibition of the CD44-HA interaction contributes to the tumor-suppressor function of merlin, and they suggest that merlin inhibits tumor growth, at least in part, by negatively regulating CD44 function PMID: 16953231

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.