Recombinant Mouse Macrophage Migration Inhibitory Factor (MIF) Protein (His)

Beta LifeScience SKU/CAT #: BLC-11198P
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Mif.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Mif.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Mif.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Mif.

Recombinant Mouse Macrophage Migration Inhibitory Factor (MIF) Protein (His)

Beta LifeScience SKU/CAT #: BLC-11198P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Macrophage Migration Inhibitory Factor (MIF) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P34884
Target Symbol MIF
Synonyms MifMacrophage migration inhibitory factor; MIF; EC 5.3.2.1; Delayed early response protein 6; DER6; Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; EC 5.3.3.12; Phenylpyruvate tautomerase
Species Mus musculus (Mouse)
Expression System Yeast
Tag N-6His
Target Protein Sequence PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Expression Range 2-115aa
Protein Length Full Length of Mature Protein
Mol. Weight 13.9 kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Subcellular Location Secreted. Cytoplasm.
Protein Families MIF family
Database References

KEGG: mmu:17319

STRING: 10090.ENSMUSP00000041149

UniGene: PMID: 29350381

  • MIF attenuates oxygen-glucose deprivation-induced cochlear cells injury. MIF enhances Nrf2 and inhibit oxidative stress in cochlear cells. Enhanced Akt-Nrf2-HO-1 pathway may mediate cochlear protection by MIF. PMID: 29908183
  • Data indicate function of macrophage migration inhibitory factor (MIF) as a regulator of the NLR family pyrin domain containing 3 (NLRP3) inflammasome complex in macrophages. PMID: 29884801
  • that macrophage migration inhibitory factor directly engages in dengue NS1-induced glycocalyx degradation and that targeting MIF may represent a possible therapeutic approach for preventing dengue-induced vascular leakage PMID: 29702687
  • our data suggests a model in which MIF expression in the primary tumor dampens the anti-tumor immune response, promoting tumor growth PMID: 29864117
  • MIF knockdown significantly accentuates hearing loss in young mice. PMID: 28990052
  • Mif mediates PAR4-induced bladder pain through urothelial HMGB1. PMID: 29263120
  • These results show although high systemic levels of MIF contribute to the development of type 2 diabetes mellitus pathology. PMID: 28780379
  • High MIF expression is associated with progressive multiple sclerosis. PMID: 28923927
  • The lack of MIF leads to disturbances of systemic and hippocampal insulin sensitivity, which are possibly responsible for memory deficits and anxiety, most likely through decreased PSA-NCAM-mediated neuroplasticity rather than through neurotrophic factors. PMID: 28919555
  • These data indicate the functional role of the MIF-COX-p53 axis in inflammation and cancer at the genomic and proteomic levels in COX-2-ablated cells. PMID: 29247872
  • Our results showed that MIF regulates MCP-1 expression in hepatocytes of injured liver via CD74, CD44, and p38 MAPK in an autocrine manner. PMID: 27273604
  • MIF is involved in the pathogenesis of AF, probably by down-regulating the protein and gene expression of Cx43 via ERK1/2 kinase activation PMID: 28429502
  • Endogenous MIF reduces the accumulation and toxicity of misfolded SOD1 in a mouse model of amyotrophic lateral sclerosis. PMID: 27551074
  • Gene expression of MIF was 30-fold higher in the heart, compared to skeletal muscle and protein expression of MIF was 3-fold higher in the heart compared to skeletal muscle. PMID: 27364992
  • renal tubular MIF is an endogenous renoprotective factor in progressive kidney diseases PMID: 28801314
  • locally produced MIF in the inflammatory bone lytic site is engaged in the chemoattraction of circulating CXCR4+ osteoclast precursor cells. PMID: 27082509
  • MIF expression was induced in chondrocytes of tissue-engineered cartilage, and could exert a profound effect on chondrocytes by promoting cartilage maturation. MIF could also regulate the phenotype of surrounding macrophages, impairing the maturation of transplanted tissues. PMID: 28574571
  • pretreatment of P. aeruginosa with rMIF is associated with reduced bacterial killing by tobramycin. PMID: 28768722
  • loss of autophagy, by pharmacological inhibition or siRNA silencing of Atg5, enhances MIF secretion by monocytes and macrophages. PMID: 27163877
  • CHD7 is an important factor in the proliferation and stemness maintenance of neural stem/progenitor cells. PMID: 27955690
  • MIF-deficient mice have reduced Nippostrongylus brasiliensis burden and mounted an enhanced type 2 immune response, including increased Gata3 expression and interleukin-13 production in the mesenteric lymph nodes PMID: 27049059
  • Sertoli cells to produce MIF under normal conditions. MIFR is expressed in GFRalpha1 and Sertoli cells. MIF induced spermatogonial cell migration PMID: 27925200
  • MIF-transgenic cells exhibited substantially decreased levels of p53 after hyperthermia treatment compared with WT and MIF-knockout cells PMID: 27528627
  • This study showed that loss of keratinocyte-derived MIF leads to a loss of control of epithelial skin tumor formation in chemical skin carcinogenesis, which highlights an unexpected tumor-suppressive activity of MIF in murine skin. PMID: 27825106
  • This study was undertaken to investigate the potential role of Macrophage migration inhibitory factor in osteoarthritis in human joint tissues and in vivo in mice with age-related and surgically induced osteoarthritis PMID: 27564840
  • MIF (macrophage migrating inhibitory factor), a potential pathogenic molecule in African trypanosomosis, was found herein to promote erythrophagocytosis, to block extramedullary erythropoiesis and RBC maturation, and to trigger hemodilution. PMID: 27632207
  • findings suggest that macrophage migration inhibitory factor regulates extramedullary erythropoiesis by inhibiting an overexpansion of splenic immature erythroid cells during chronic stress and indicate a novel role for this cytokine under chronic stress conditions PMID: 27129368
  • Findings suggest that Mif plays a role in the molecular mechanisms of macrophage and dendritic cell activation and drives T cell responses involved in the pathology of type 1 diabetes mellitus. PMID: 27699180
  • MIF has a potential role in pathological angiogenesis of proliferative retinopathy. PMID: 28070752
  • genetic Mif deletion reduces the incidence and severity of oral carcinogenesis, by inhibiting the expression of chronic pro-inflammatory immune mediators. Thus, targeting MIF is a promising strategy for the prevention or therapy of oral cancer. PMID: 27164411
  • MIF inhibits the myoblast differentiation by affecting the cell cycle progression, but does not affect proliferation. PMID: 26927414
  • this paper shows that the detrimental effect of MIF knockout was associated with accentuated loss in cardiac autophagy with aging PMID: 26940544
  • our results suggest that MIF promotes mCSC survival, proliferation and endothelial differentiation through the activation of the PI3K/Akt/mTOR and AMPK signaling pathways. PMID: 27035848
  • Posttranslational modification of MIF by S-nitrosation results in intracellular accumulation and protection from myocardial ischemia reperfusion injury. PMID: 26310191
  • Data show that the siRNA-induced macrophage migration inhibitory factor (MIF) reduction in murine mammary cancer line 4T1 and human breast cancer line MDA-MB-231 resulted in significant reduction of cell proliferation and increase of apoptosis. PMID: 26403072
  • High expression levels of macrophage migration inhibitory factor sustain the innate immune responses of neonates. PMID: 26858459
  • The deletion of the MIF gene led to reduced behavioural despair in mice of both sexes and IFN-gamma mRNA levels were reduced in the hippocampus of the MIF KO mice. PMID: 26338025
  • In D-galactosamine-sensitized mice CP+Cu(II) increased the LPS-induced lethality from 54 to 100%, while administration of antibodies against MIF prevented the lethal effect. The enhancement by CP+Cu(II) of the pro-inflammatory signal of MIF is discussed. PMID: 26091949
  • data suggest that the MIF-Notch axis may play an important role in the pathogenesis of experimental autoimmune uveitis PMID: 26400205
  • The functional role of MIF in cell recruitment was investigated by a chemotaxis assay and by flow cytometry of labeled macrophages that were injected into Mif-/-and wildtype mice PMID: 26348853
  • these results implicate MIF in the pathogenesis of esophageal inflammation and suggest that targeting MIF might represent a novel therapy for EoE. PMID: 25712805
  • Data suggest that macrophage migration inhibitory factor (MIF) inhibition could be a promising approach to the treatment of diabetes mellitus (DM)-associated atherosclerosis (AS). PMID: 25661015
  • Bladder PAR activation elicits urothelial MIF release and urothelial MIF receptor signaling at least partly through CXCR4 to result in abdominal hypersensitivity without overt bladder inflammation PMID: 26020638
  • Transcription factor MEF2 and Zac1 mediate MIF-induced GLUT4 expression through CD74-dependent AMPK activation in cardiomyocytes PMID: 26455966
  • Blockade of CXCR7 suppressed MIF-mediated ERK- and zeta-chain-associated protein kinase (ZAP)-70 activation PMID: 26139098
  • Macrophage migration inhibitory factor is detrimental for survival and is associated with lung pathology, inflammatory cellular infiltration, and bacterial replication in a mouse model of pneumococcal pneumonia. PMID: 25943202
  • Macrophage migration inhibitory factor may play an important role in recovery from acoustic trauma PMID: 25853607
  • data indicate that MIF and CD74 facilitate RANKL-induced osteoclastogenesis, and suggest that MIF contributes directly to bone erosion, as well as inflammation, in rheumatoid arthritis PMID: 25647268
  • MIF was found to be a major platelet-derived chemotactic recruitment factor with clot-modulating properties and therefore might be relevant in inflammatory diseases such as atherosclerosis PMID: 25561410
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed