Recombinant Mouse Lymphocyte Antigen 6C1 (LY6C1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10631P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ly6c1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ly6c1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ly6c1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ly6c1.

Recombinant Mouse Lymphocyte Antigen 6C1 (LY6C1) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10631P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Lymphocyte Antigen 6C1 (LY6C1) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P0CW02
Target Symbol LY6C1
Synonyms Ly6c1; Lymphocyte antigen 6C1; Ly-6C1
Species Mus musculus (Mouse)
Expression System Yeast
Tag N-6His
Target Protein Sequence LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Expression Range 27-109aa
Protein Length Full Length of Mature Protein
Mol. Weight 11.1kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor.
Database References

KEGG: mmu:17067

STRING: 10090.ENSMUSP00000066954

UniGene: PMID: 28534119

  • CX3CL1 is upregulated in both human and murine tumors following VEGF signaling blockade, resulting in recruitment of CX3CR1+Ly6Clo monocytes into the tumor PMID: 28691930
  • surface expression on Ly6C(high) monocytes changes in a time-of-day-dependent manner, which crucially affects cardiac monocyte recruitment after an acute ischemic event. PMID: 28663258
  • monocyte differentiation occurred through de novo enhancer establishment and activation of pre-established (poised) enhancers. Generation of Ly6C(-) monocytes involved induction of the transcription factor C/EBPbeta and C/EBPbeta-deficient mice lacked Ly6C(-) monocytes. PMID: 28514690
  • Ly6C, 4-1BB, and KLRG1 have roles in the activation of lamina propria lymphocytes in the small intestine in a mouse model of Crohn's disease PMID: 28011265
  • The adapter Mal (encoded by TIRAP) has appeared crucial for the cytokine production by Ly6C(lo) but not by Ly6C(hi) monocytes. The protein Mal was necessary to induce cytokine synthesis by Ly6C(lo) monocytes after triggering TLR2 or TLR9. PMID: 27646001
  • Data show that Ly6C(high) monocyte subset after middle cerebral artery occlusion/reperfusion (MCAO/R) peaked on day 2 after the operation and was correlated with cerebral infarct size. PMID: 26927544
  • Chronic parasitic infection maintains high frequencies of short-lived Ly6C+CD4+ effector T cells that are required for protection against re-infection. PMID: 25473946
  • Monocytes expressing Ly-6C orchestrate both inflammatory and reparative phases during myocardial infarction. PMID: 24625784
  • MPYS-deficient Ly6C(hi) monocytes are intrinsically defective in migration to the liver, but not the spleen. PMID: 23378430
  • Differential Ly-6C expression identifies the recruited macrophage phenotype, which orchestrates the regression of murine liver fibrosis. PMID: 23100531
  • Identify for the involvement of inflammatory Ly-6C(hi) monocytes in the pathogenesis of transplant arteriosclerosis, particularly in conditions of hyperlipidemia. PMID: 22704806
  • decreased Ly6C and T-bet (Tbx21) expression distinguished a subset of Th1 cells that displayed greater longevity and proliferative responses to secondary infection PMID: 22018471
  • TNF-alpha-dependent regulation of acute pancreatitis severity by Ly-6C(hi) monocytes in mice. PMID: 21343291
  • Ly6C(high-expressing) and Ly6C(low-expressing) bone marrow (BM)-derived monocytes have different fates, demonstrating that BM may be a reservoir of preinflammatory monocytes for rapid deployment as inflammatory dendritic cells during virus infection. PMID: 21248254
  • in vitro and in vivo differentiation of naive CD8(+) T cells into central (Tcm) but not effector (Tem) memory T cells enhances Ly6C expression, and its crosslinking induces strong LFA-1 clustering on Tcm PMID: 21308682
  • The tumor-monocyte pool almost exclusively consisted of Ly6C(hi)CX(3)CR1(low) monocytes, which continuously seeded tumors and renewed all nonproliferating tumor associated macrophages subsets. PMID: 20570887
  • Th1 but not Th2 cytokine environments transiently induce the expression of Ly-6C on B cells. There are differences in the regulation of Ly-6C expression in Ly6.1 and Ly6.2 strains. PMID: 12184918
  • Ly6C when cross-linked is able to regulate endothelial adhesion of CD8 T cells via activation of LFA-1 in a manner that involves Ly6C down-regulation on the cell surface. PMID: 12538687
  • During systemic listeria infection, a subset of Ly-6C-expressing monocytes transports L. monocytogenes into the brain and establishes its role of bacterial spreading in vivo. PMID: 15034057
  • plasmacytoid dendritic cells can only be derived from the CD31(high)/Ly6C(-) subset, the subset that reportedly contains the highest frequency of early and late cobblestone area forming cells PMID: 17084826
  • Ly-6C(hi) monocytes represent a newly recognized component of the inflammatory response in experimental atherosclerosis. PMID: 17200719
  • In resting lung, Ly-6C(high)CCR2(high) monocytes repopulate CD103-positive dendritic cells (DCs) using a CCR2-dependent mechanism, and these DCs preferentially retain residual CCR2 in the lung. PMID: 18292524
  • DeltaactA-infected IFN-gamma-/- mice had no brain influx of Ly-6Chigh monocytes despite normal monocyte trafficking from bone marrow to blood and spleen PMID: 18566419
  • Data suggest that CCL2-dependent, Ly6C+ inflammatory monocyte migration is critical for increases in microglia during West Nile Virus infection and may also play a pathogenic role during WNV encephalitis. PMID: 18779347
  • Granulocyte-macrophage colony-stimulating factor-driven release of Ly6C(hi) precursors from the bone marrow prevents exhaustion of central nervous system myeloid populations during relapsing or chronic autoimmune demyelination. PMID: 19196868
  • Ly6C(low-expressing) mature monocytes can promote tolerance to self antigen contained in apoptotic cells through a programmed death ligand (PDL-1)-dependent mechanism. PMID: 19234172
  • Gr-1 Ab induces signals leading to myelopoiesis and affects myeloid-derived suppressor cell activity, suggesting functional roles for Ly-6C/G molecules in macrophage differentiation and neutrophil apoptosis. PMID: 19830733
  • Ly6C is a marker of macrophage subsets and support a model of selective recruitment of Ly6C(high) bone marrow monocytes to the kidney that differentiate into three populations of kidney macrophages, including a profibrotic Ly6C(low) population. PMID: 19864592
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed