Recombinant Mouse Lymphocyte Antigen 6A-2/6E-1 (LY6A) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-01578P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Lymphocyte Antigen 6A-2/6E-1 (LY6A) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-01578P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Lymphocyte Antigen 6A-2/6E-1 (LY6A) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P05533
Target Symbol LY6A
Synonyms Ly-6A.2/Ly-6E.1;Stem cell antigen 1;SCA-1;T-cell-activating protein;TAP
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG
Expression Range 27-112aa
Protein Length Full Length of Mature Protein
Mol. Weight 16.7 kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function T-cell activation.
Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor.
Database References

KEGG: mmu:110454

STRING: 10090.ENSMUSP00000023248

UniGene: PMID: 28732240

  • Sca-1 is a novel cancer stem cells enrichment marker. PMID: 26869189
  • IL-27-induced Sca-1(+) T cells had increased expression of effector/memory-associated transcription factor T-bet, Eomes and Blimp1. PMID: 28758191
  • SCA-1 enriches for an ERalpha(+), estrogen-sensitive subpopulation within the CD24(+)/CD49f(hi) MaSC population that may be responsible for the hormonal sensitivity of the developing mammary gland. PMID: 28132885
  • Upregulation of leptin levels in both the vessel wall and the circulation after vessel injury promoted the migration of Sca-1(+) progenitor cells via leptin receptor-dependent signal transducer and activator of transcription 3- Rac1/Cdc42-ERK (extracellular signal-regulated kinase)-FAK pathways, which enhanced neointimal formation. PMID: 28935755
  • Both the number of lung CD31-CD45-Sca-1+ cells and the expression levels of the Shh signaling pathway were downregulated in the lung tissues of mice with pulmonary emphysema. These cells and Shh signaling pathway are reactivated during acute adenovirus infection. PMID: 28352167
  • we report significantly higher expression of the immunoglobulin light chain by B cells in lamina propria of Ly-6A/Sca-1deficient mice when compared to the wild-type control. PMID: 27322740
  • c-Myb regulates proliferation/differentiation of adventitial Sca1+ vascular smooth muscle progenitor cells by transcriptional activation of myocardin. PMID: 27174098
  • sca-1 antibody reduces both CD34+/c-kit+ progenitor cell surge and vascular restenosis after endoluminal vascular injury in a murine model. PMID: 27666446
  • Results indicate that IL-17A promotes tumorigenicity of colon cancer cells by enhancing cell cycle progression and directly induces the expression of Sca-1. PMID: 27378226
  • Study provides evidence that up-regulation of miRNA-21 can promote migration and proliferation of Sca-1+ CSCs to enhance the capacity of Sca-1+ CSCs to repair damaged myocardium. PMID: 27210794
  • the androgen-independent and bipotent organoid-forming Sca-1(+) luminal cells as a functionally distinct cellular entity, is reported. PMID: 26418304
  • Sphingosylphosphorylcholine promotes the differentiation of resident Sca-1 positive cardiac stem cells to cardiomyocytes through lipid raft/JNK/STAT3 and beta-catenin signaling pathways. PMID: 27066979
  • Data show that bisperoxovanadium (BpV) treatment induces specific epigenetic modifications at the promoter regions of genes associated with stem cell fate, including Sca-1 and Pw1. PMID: 26672000
  • The results suggested that the depletion of the progenitor cell pool and DNA methylation of Sca-1 gene may be involved in the progression of emphysema in mice. PMID: 26264445
  • PDGFRalpha has a role in demarcating the cardiogenic clonogenic Sca1+ stem/progenitor cell in adult murine myocardium PMID: 25980517
  • The progenitor phenotype of the Sp-C(+)Sca-1(+) cells that mediates alveolar epithelial repair might involve Wnt signaling. PMID: 25474582
  • Subcutaneous and visceral fat-derived Sca1(high) ASCs particularly differ in the gene expressions of adhesion and ECM molecules. PMID: 24726953
  • The more aggressive behavior of Ly6a/Sca-1 expressing leukemias is due at least in part to greater capacity to degrade microenvironmental stroma and invade tissues. PMID: 24586463
  • Reversal of ischemic cardiomyopathy with Sca-1+ stem cells modified with multiple growth factors. PMID: 24705272
  • Sca1 and bromodeoxyuridine positive cells may participate in the formation of new thyroid follicles after partial thyroidectomy. PMID: 24278321
  • Sca1 positive murine pituitary adenoma cells show tumor-growth advantage. PMID: 24481638
  • The high and specific expression of stem cell antigen 1 (Sca1) in TtT/GF cells was confirmed by real-time polymerase chain reaction. PMID: 23881407
  • Application of hematopoietic progenitor (lin-/sca-1+) or endothelial progenitor cells potentially improves the inflammatory and oxidative stress parameters in an atherosclerosis model. PMID: 22622053
  • the A2B receptor signaling linked to up-regulation of pro-angiogenic factors in cardiac Sca-1(+)CD31(-) stromal cells is essential for overall improvement of cardiac recovery seen after their transplantation to the injured heart. PMID: 23827818
  • Report the distribution of c-kit/Sca-1/CXCR4 expressing cardiac stem cells in the different compartments of the heart and significant reduction in their number in adult heart. PMID: 23273785
  • Sca-1(-) Plasmacytoid dendritic cells are an early developmental stage of Plasmacytoid dendritic cells with distinct innate functions representing the true murine natural IFN-alpha-producing cells. PMID: 23922217
  • These results demonstrate that TLR4/Sca-1 signaling plays an important role in the regulation of hematopoietic precursor cell programming and their enhancement of granulocyte lineage commitment in response to E. coli bacteremia. PMID: 23545304
  • PECAM1(+)/Sca1(+)/CD38(+) vascular cells could proliferate and differentiate into myofibroblast-like cells in wound repair. PMID: 23308177
  • Sca-1(+) cells expressed markedly higher levels of mammary stem cell-related genes in comparison to Sca-1(-) cells. PMID: 22634533
  • Identification of a population of LY6A+ mouse ovarian surface epithelium progenitor cells on the surface of the ovary that may play a role in ovulatory wound healing. PMID: 22914315
  • results of this study suggest that increased Sca1 expression on erythropoietic precursors inhibits erythroid differentiation PMID: 23246681
  • Sca-1 protects against cardiac hypertrophy and fibrosis via regulation of multiple pathways in cardiomyocytes. PMID: 22851736
  • Data show that deletion of Sca-1 causes primary cardiac defects in myocardial contractility and repair consistent with impairment of resident cardiac progenitor cell proliferative capacity. PMID: 22800687
  • Sca-1 is either redundant or a nonessential marker of adipose progenitor/stem cells. PMID: 21510817
  • Studies suggest that the cloned Sca-1+CD45- cells confer the therapeutic benefits of Cardiospheres (CSs) in the mouse myocardial infarction (MI) model. PMID: 22272337
  • Sca-1 is a negative regulator of the tumor suppressor effects of PPARgamma PMID: 21955520
  • enhanced Sca-1 expression facilitates activation of the ERK pathway and supports the proliferation of myeloid and granulopoietic precursors during bacteremia; alcohol intoxication suppresses this response PMID: 22238460
  • MicroRNA-126 modulates endothelial SDF-1 expression and mobilization of Sca-1(+)/Lin(-) progenitor cells in ischaemia. PMID: 21856785
  • These data demonstrate the crucial role of Sca-1 in the maintenance of cardiac integrity and suggest that Sca-1 restrains spontaneous differentiation in the precursor population. PMID: 21957128
  • Results imply that Sca-1-positive cells may have a role in the duct cell proliferation in the regeneration step elicited by excretory duct ligation-induced injury. PMID: 21884259
  • Postulate that SCA1(+)/CD31(+) cardiac side population cells may represent endothelial progenitor cells in the mouse heart. PMID: 21615679
  • Hematopoietic lineage cells with Sca-1(high) expression and CD62L(neg/low) expression are characterized as multipotent progenitor cells, based on transient engraftment. PMID: 21998453
  • Ly6a as a candidate gene for functional involvement in novelty responsiveness PMID: 21673958
  • Inhalation of acrolein increases apoptosis and suppresses the circulating levels of Flk-1(+)/Sca-1(+) cells while increasing these cells in the bone marrow and preventing their mobilization by VEGF. PMID: 21527748
  • Sca-1 attenuated GDF10-dependent TGF-beta signaling by disrupting the heterodimerization of TbetaRI and TbetaRII receptors. PMID: 21518866
  • TGF-beta1 represses Sca-1 expression in T cells and other immune cell populations derived from the spleen, indicating that regulation by TGF-beta1 is a general feature of Sca-1 expression in multiple cell types PMID: 21156809
  • Sca-1-/- mice have a defect in their capacity to recruit soluble IgM, and subsequently C3 complement, to damaged muscle. There was a significant reduction in B-1a cells in Sca-1-/- mice. PMID: 21123737
  • Prior exposure of mesenchymal stem cells to hypoxia led to a significant reduction of ex vivo expansion time, with significantly increased numbers of Sca-1(+) as well as Sca-1(+)/CD44(+)double-positive cells. PMID: 20496083
  • Ly-6C(hi) monocytosis disturbs resolution of inflammation in murine infarcts and consequently enhances left ventricular remodeling. PMID: 20378083
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed