Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor Iii (FCGR3) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08980P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor Iii (FCGR3) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08980P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor Iii (FCGR3) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P08508 |
| Target Symbol | FCGR3 |
| Synonyms | Fcgr3Low affinity immunoglobulin gamma Fc region receptor III; IgG Fc receptor III; Fc-gamma RIII; FcRIII; CD antigen CD16 |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT |
| Expression Range | 31-215aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 37.2kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b. Mediates neutrophil activation by IgG complexes redundantly with Fcgr4. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Database References | STRING: 10090.ENSMUSP00000131938 UniGene: Mm.22119 |
