Recombinant Mouse Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 3 (LILRB3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00781P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 3 (LILRB3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00781P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 3 (LILRB3) Protein (His) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P97484 |
Target Symbol | LILRB3 |
Species | Mus musculus (Mouse) |
Expression System | Mammalian cell |
Tag | C-6His |
Target Protein Sequence | SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK |
Expression Range | 25-642aa |
Protein Length | Partial |
Mol. Weight | 70.8 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Detected in macrophages, splenocytes and B lymphocytes (at protein level). Detected in macrophages, mast cells, splenocytes, peritoneal cells and natural killer cells. |
Gene Functions References
- Loss of gp91 is associated with Bone resorption. PMID: 27897222
- Results imply a neuron-specific, cell-autonomous action of PirB on synaptic density in L2/3 pyramidal cells of visual cortex; suggest that PirB is needed to match spine density and excitatory synaptic function to activity levels within cortical circuits, thereby providing headroom for the cell to encode additional experiences at new synapses. PMID: 27752542
- peripheral CD4+ T cells from spontaneous murine arthritis model frequently express PIR-B PMID: 28664612
- These results provide evidence for a critical role of the major histocompatibility complex class I/PirB signaling system in the generation of asymmetries in hippocampal circuitry. PMID: 28594961
- These data identify paired Ig-like receptor B as a molecular checkpoint in IL-13-induced eosinophil accumulation and activation PMID: 27324131
- the overexpression of PirB inhibits the neuronal survival through increased neuron apoptosis PMID: 27443384
- neural plasticity in adult visual cortex is actively repressed and can be enhanced by blocking PirB function. PMID: 25320232
- The Nogo-B-PirB axis controls macrophage-mediated vascular remodeling. PMID: 24278366
- PIRB and LILRB2 were expressed in mouse and human platelets, respectively. PMID: 25075127
- NogoA receptors, NogoR1 and PirB, are expressed in the ventricular zone where neural stem cells reside. PMID: 24449409
- PirB expression is up-regulated after transient focal cerebral ischaemia. It may play pathologic roles in the inhibition of axonal regeneration after stroke. PMID: 23927735
- PirB normally regulates spine and excitatory synapse density and consequently the threshold for new learning throughout life. PMID: 24302763
- In mice, the deleterious effect of Abeta oligomers on hippocampal long-term potentiation required PirB, and in a transgenic model of Alzheimer's disease, PirB not only contributed to memory deficits present in adult mice, but also mediated loss of synaptic plasticity in juvenile visual cortex. PMID: 24052308
- a key role for PIR-B in IPF, likely via the regulation of macrophage activation PMID: 23258232
- study indicates an unexpected functional significance of classical immune-inhibitory receptors in maintenance of stemness of normal adult stem cells and in support of cancer development PMID: 22660330
- findings, coupled with previous studies, may imply that PirB is probably a critical molecule in inhibition of axonal regeneration by myelin inhibitors after ON injury PMID: 22102155
- This study demonistrated that significant neuroprotection in the absence of the innate immune receptor PirB in mice model of stroke. PMID: 22445338
- the p75 receptor is required for the signal transduction of PIR- PMID: 21881600
- the major promoter of Pirb, and probably Pira as well, is activated dominantly by PU.1 and marginally by Runx3 in B cells. PMID: 21555536
- a novel mechanism by which PIR-B-mediated regulation is achieved differentially but competitively via MHCI and Nogo in cells of the immune system PMID: 21636572
- Thus, PIR-B associated with Trk to downregulate basal and neurotrophin-regulated Trk activity through SHP-1/2 in neurons. PMID: 21364532
- myeloid-derived suppressor cells genetically ablated for PIR-B underwent a specific transition to M1-like cells when entering the periphery from bone marrow, resulting in decreased suppressive function, regulatory T cell activation activity. PMID: 21376641
- PIR-B is an important regulator of innate immunity mediated by TLR9 in B-1 cells, which can otherwise provoke autoimmunity when overactivated (Review) PMID: 20976309
- PIR-B knock-out is not sufficient to induce extensive axonal regeneration after spinal cord injury. PMID: 21087927
- PirB and Nogo receptor-1 participate in ligand-dependent inhibition of synaptic plasticity in hippocampal slice cultures of adult mice. PMID: 20844138
- Blocking the function of PirB is not sufficient to promote axonal reorganization or functional recovery after motor cortex injury. PMID: 20881122
- PIR-B negatively regulates macrophage functions in response to pathogenic bacteria and chronic intestinal inflammatory responses. PMID: 20398663
- PIR-B is critical for B cell suppression, DC maturation and for balancing T(H)1 and T(H)2 immune responses. PMID: 12021780
- HLA-G inhibits the functions of murine dendritic cells via the PIR-B immune inhibitory receptor. PMID: 12207326
- Mast cell regulation via paired immunoglobulin-like receptor PIR-B. Review. PMID: 12403357
- PIR-B plays a role in regulating signal strength in adhesion-mediated activation of myeloid cells. PMID: 15494528
- Hck and Fgr function as negative regulators of myeloid cell chemokine signaling by maintaining the tonic phosphorylation of PIR- PMID: 15723811
- PirB, a major histocompatibility complex class I (MHCI) receptor, is expressed in central nervous system neurons and functions to limit the extent of experience-dependent plasticity in the visual cortex throughout life PMID: 16917027
- We identify murine-paired Ig-like receptor (PIR)-B, and its human orthologs Ig-like transcript 2 and Ig-like transcript 5 as novel receptors for Staphylococcus aureus. PMID: 17371981
- constitutive cis binding between LILRB2 or PIR-B and major histocompatibility complex class I has an essential role in regulating allergic responses PMID: 17420263
- These findings indicate that sialylated O-linked sugar structures on CD99 play an important role in the recognition of PILR. PMID: 18209065
- a single receptor can have dual functionality in distinct cell types after unique cellular signals PMID: 18316626
- paired Ig-like receptor (PIR)-B, an MHC-I receptor expressed on antigen-presenting cells, can regulate CTL triggering by blocking the access of CD8 molecules to MHC-I PMID: 18787130
- Deletion of PIR-B does not significantly alter either osteoclast or osteoblast function in vivo, at least up to 6 mo of age. PIR-B-deficient mice are not osteoporotic. PMID: 18802077
- study found PirB, which has been implicated in nervous system plasticity, is a high-affinity receptor for Nogo, MAG, and OMgp; results implicate PirB in mediating axonal regeneration block PMID: 18988857
- T cell expression of PIR-B with the cis-interacting MHC class I is strictly prohibited in periphery so as to secure prompt immune responses. PMID: 19684158
- PIR-B on relatively primitive B cells, B-1 cells, suppresses TLR9 signaling via Bruton's tyrosine kinase (Btk) dephosphorylation, blocking the production of natural IgM antibodies. PMID: 19687229