Recombinant Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 1 (KLRG1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01072P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 1 (KLRG1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01072P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 1 (KLRG1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | O88713 |
| Target Symbol | KLRG1 |
| Synonyms | (Mast cell function-associated antigen 2F1) |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY |
| Expression Range | 57-188aa |
| Protein Length | Partial |
| Mol. Weight | 22.4 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells. |
| Subcellular Location | Cell membrane; Single-pass type II membrane protein. |
| Database References | KEGG: mmu:50928 STRING: 10090.ENSMUSP00000032207 UniGene: PMID: 28437001 |
