Recombinant Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 1 (KLRG1) Protein (His&Myc)

Name: Recombinant Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 1 (KLRG1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01072P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 1 (KLRG1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O88713
Target Symbol	KLRG1
Synonyms	(Mast cell function-associated antigen 2F1)
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
Expression Range	57-188aa
Protein Length	Partial
Mol. Weight	22.4 kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.
Subcellular Location	Cell membrane; Single-pass type II membrane protein.
Database References	KEGG: mmu:50928 STRING: 10090.ENSMUSP00000032207 UniGene: PMID: 28437001 Although absence of KLRG1 is not enough to increase intestinal Treg cells in KLRG1 knockout mice, KLRG1 ligation reduces T-cell receptor signals and the competitive fitness of individual Treg cells in the intestine. PMID: 28437578 This finding provides a rationale for the reciprocal expression of KLRG1 and CD103 in different CD8(+) T-cell subsets. PMID: 26014037 Cytotoxic KLRG1-expressed CD8 effector cells and defective T regulatory cells cause murine autoimmune cholangitis. PMID: 24556277 KLRG1(+) iNKT cells coexpressing CD49d and granzyme A persisted for several months and displayed a potent secondary response to cognate antigen. PMID: 25118276 Data indicate that CD103(+)CD8(+) T(RM) cells developed in the skin from epithelium-infiltrating precursor cells that lacked expression of the effector-cell marker KLRG1. PMID: 24162776 Data indicate that increments of CD8 + effector memory T cells in human and mouse chronic lymphocytic leukemia (CLL)(Emu-TCL1 model) were due to an expansion of the inhibitory killer cell lectin-like receptor G1 (KLRG1) expressing cellular subset. PMID: 24022692 Despite their differences, KLRG1+ and KLRG1- Treg cells proved similarly potent in suppressing experimental autoimmune encephalomyelitis. PMID: 23436224 KLRG1(-/-) mice had a significant survival extension after Mycobacterium tuberculosis infection compared to wild-type controls, and maintained a significantly lower level of pulmonary bacterial load throughout chronic infection. PMID: 23340310 CD8+ T cells lacking Id2 do not generate a robust terminally differentiated killer cell lectin-like receptor G1 (KLRG1hi) effector population, but display a cell-surface phenotype and cytokine profile consistent with memory precursors. PMID: 23325888 The lower inhibitory capacity of mKLRG1 compared with hKLRG1 can thus be rationalized by a decreased proportion of dimeric entities, which can be pinpointed to a single amino acid. PMID: 22684915 KLRG1high-expressiong CD8 T cells isolated from the lung during the peak of influenza infection could long survive in vitro and participate in a recall response to influenza virus infection upon adoptive transfer. PMID: 23089397 The KLRG1+NKG2A+ positive phenotype correlates with protective efficacy for generating effector and proliferative memory responses from a pool of CD8 T cells during persistent gamma-herpesvirus 68 infection. PMID: 21346231 Interleukin-2-activated natural killer cells interact with tumor necrosis factor-alpha-stimulated endothelial cells to induce their proliferation and promote angiogenesis through a mechanism involving alpha4beta7 integrin and KLRG1. PMID: 20971926 KLRG1 does not play a deterministic role in the generation & functional characteristics of NK & T-cell subsets. The inhibitory potential of KLRG1 in mice is weak. Strong activation signals during viral infections may override the inhibitory signal. PMID: 20201037 Both pathogenic and nonpathogenic in vivo activation of NK cells induces cell surface expression of KLRG1, while in vitro studies show that engagement of the receptor on a transfected NK cell line inhibits cytokine production and cell-mediated cytoxicity. PMID: 11884419 Expression of KLRG1 on CD8+ and CD4+ T cell subsets isolated from naive animals appears to be largely restricted to T cells that exhibit a memory phenotype. PMID: 12794113 MafA is differentially expressed in beta-cells where it regulates insulin gene expression. PMID: 14765989 repetitive and persistent antigen stimulation leads to an increase in KLRG1 expression of virus-specific CD8+ T cells PMID: 16140789 KLRG1 ligation by E-, N-, or R-cadherins may regulate the cytotoxicity of killer cells to prevent damage to tissues expressing cadherins. PMID: 16461340 Upon phosphorylation of the immunoreceptor tyrosine-based inhibitory motif tyrosine, KLRG1 recruits both SHIP-1 and SHP-2 but not SHP-1. PMID: 17307799 NK cells acquire KLRG1 on their surface during development, and this expression correlates with functional distinctions from other peripheral NK cells in vivo. PMID: 17404256 IL-12 signaling drives CD8+ T cell IFN-gamma production and differentiation of KLRG1+ effector subpopulations during Toxoplasma gondii Infection. PMID: 18424713 KLRG1 formed multimeric protein complexes in T cells in addition to the previously described mono- and dimeric molecules PMID: 19009530 KLRG1 recognizes the N-terminal homodimeric interface of domain 1 of E-cadherin and binds only the monomeric form of E-cadherin to inhibit the immune response. PMID: 19654330 our results provide novel insights on how KLRG1 and E-cadherin interactions are integrated to differentially regulate not only KLRG1(+) cells, but also E-cadherin-expressing cells, such as dendritic cells. PMID: 19855082

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.