Recombinant Mouse Killer Cell Lectin-Like Receptor 3 (KLRA3) Protein (His)

Name: Recombinant Mouse Killer Cell Lectin-Like Receptor 3 (KLRA3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08830P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Killer Cell Lectin-Like Receptor 3 (KLRA3) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q64329
Target Symbol	KLRA3
Synonyms	Klra3; Ly-49c; Ly49C; Killer cell lectin-like receptor 3; 5E6; Lymphocyte antigen 49c; Ly-49c; Nk2.1; T-cell surface glycoprotein Ly-49C
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD
Expression Range	70-266aa
Protein Length	Partial
Mol. Weight	27.6 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor on natural killer (NK) cells for class I MHC.
Subcellular Location	Membrane; Single-pass type II membrane protein.
Database References	KEGG: mmu:16634 STRING: 10090.ENSMUSP00000085333 UniGene: PMID: 27385590 murine cytomegalovirus infection results in altered NK cell activation PMID: 24873973 we have shown for the first time how the differential expression of the Ly49 inhibitory receptors during ontogeny can affect NK cell function PMID: 23960238 This study showed that mPer2 is a critical clock component in modulating circadian rhythms in bone marrow, and it implies that Ly49C and Nkg2d may play an important role in mediating mPer2-controlled cytotoxic response. PMID: 20030538 Three mutations have been introduced in Ly49C that correspond to Ly49A residues close to H-2Dd in the co-crystal, demonstrating that MHC class I binding by Ly49C is dependent on residues in the same area as that used by Ly49A for ligand contacts. PMID: 11777974 signaling through the mouse NK inhibitory receptor Ly49C requires the presence of H-2Kb and this signaling is prevented when H-2Kb is ablated by pulsing with a peptide that can bind to it with high affinity PMID: 16148097 adoptive infusion of alloreactive NK cells with silenced Ly49C gene results in suppression of graft-versus-host disease PMID: 19010415

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.